JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB114233

Recombinant Human Sortilin/NT3 protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human Sortilin/NT3 protein is a Human Fragment protein, in the 203 to 299 aa range, expressed in Wheat germ, suitable for SDS-PAGE, ELISA, WB.

View Alternative Names

Sortilin, 100 kDa NT receptor, Glycoprotein 95, Neurotensin receptor 3, Gp95, NT3, NTR3, SORT1

1 Images
SDS-PAGE - Recombinant Human Sortilin/NT3 protein (AB114233)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human Sortilin/NT3 protein (AB114233)

12.5% SDS-PAGE showing ab114233 at approximately 36.30kDa stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

ELISA, SDS-PAGE, WB

applications

Biologically active

No

Accession

Q99523

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.3% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p>(Recombinant protein).</p>" } } }

Sequence info

[{"sequence":"FAKNFVQTDLPFHPLTQMMYSPQNSDYLLALSTENGLWVSKNFGGKWEEIHKAVCLAKWGSDNTIFFTTYANGSCKADLGALELWRTSDLGKSFKTI","proteinLength":"Fragment","predictedMolecularWeight":"36.3 kDa","actualMolecularWeight":null,"aminoAcidEnd":299,"aminoAcidStart":203,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"Q99523","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Sortilin also known as NT3 receptor is a type I membrane protein with an approximate molecular mass of 100 kDa. It is expressed in various tissues especially the central nervous system and adipose tissue. Sortilin belongs to the Vps10p domain receptor family and functions in intracellular protein sorting. Its primary role involves the transport and signaling of neurotrophins particularly NT-3 protein (neurotrophin-3) which is vital for neuronal growth and survival.
Biological function summary

NT-3 protein influences the development and differentiation of the nervous system. Sortilin serves as a receptor for NT-3 facilitating the interaction with the TrkC receptor on neuronal cells. Sortilin forms a complex with NT-3 contributing to critical cellular processes. Being part of this receptor complex Sortilin modulates neuron-related signaling pathways which are essential for neurogenesis and synaptic plasticity.

Pathways

Sortilin and NT-3 play significant roles in the neurotrophin signaling pathway and influence the MAPK signaling cascade. These pathways are pivotal in neuron survival differentiation and growth. NT-3 interacts with other proteins such as TrkC and p75 to propagate these signals. Through its association with TrkC receptor Sortilin mediates critical cellular responses linked to neurotrophin signaling. The interplay between these proteins allows precise regulation of neuronal activities in various physiological states.

NT-3 and Sortilin have associations with neurodegenerative conditions such as Alzheimer's disease and metabolic disorders like obesity. Dysregulation of Sortilin can contribute to abnormal NT-3 signaling affecting neuronal homeostasis. The protein also shows links with amyloid precursor protein (APP) in Alzheimer's disease where abnormal interactions may exacerbate disease progression. Understanding the dynamics of Sortilin in these conditions can offer insights into potential therapeutic approaches.

Specifications

Form

Liquid

General info

Function

Functions as a sorting receptor in the Golgi compartment and as a clearance receptor on the cell surface. Required for protein transport from the Golgi apparatus to the lysosomes by a pathway that is independent of the mannose-6-phosphate receptor (M6PR). Lysosomal proteins bind specifically to the receptor in the Golgi apparatus and the resulting receptor-ligand complex is transported to an acidic prelysosomal compartment where the low pH mediates the dissociation of the complex (PubMed : 16787399). The receptor is then recycled back to the Golgi for another round of trafficking through its binding to the retromer. Also required for protein transport from the Golgi apparatus to the endosomes. Promotes neuronal apoptosis by mediating endocytosis of the proapoptotic precursor forms of BDNF (proBDNF) and NGFB (proNGFB). Also acts as a receptor for neurotensin. May promote mineralization of the extracellular matrix during osteogenic differentiation by scavenging extracellular LPL. Probably required in adipocytes for the formation of specialized storage vesicles containing the glucose transporter SLC2A4/GLUT4 (GLUT4 storage vesicles, or GSVs). These vesicles provide a stable pool of SLC2A4 and confer increased responsiveness to insulin. May also mediate transport from the endoplasmic reticulum to the Golgi.

Sequence similarities

Belongs to the VPS10-related sortilin family. SORT1 subfamily.

Post-translational modifications

The N-terminal propeptide is cleaved by furin and possibly other homologous proteases.. Palmitoylated (PubMed:18817523). Undergoes cysteine S-palmitoylation which promotes the partitioning of the receptor into an endosomal membrane subdomain where it can interact with the retromer cargo-selective complex which mediates its retrograde trafficking to the Golgi apparatus (PubMed:18817523).. Phosphorylation at Ser-825 facilitates the interaction with GGA1.

Subcellular localisation

Endosome membrane

Product protocols

Target data

Functions as a sorting receptor in the Golgi compartment and as a clearance receptor on the cell surface. Required for protein transport from the Golgi apparatus to the lysosomes by a pathway that is independent of the mannose-6-phosphate receptor (M6PR). Lysosomal proteins bind specifically to the receptor in the Golgi apparatus and the resulting receptor-ligand complex is transported to an acidic prelysosomal compartment where the low pH mediates the dissociation of the complex (PubMed : 16787399). The receptor is then recycled back to the Golgi for another round of trafficking through its binding to the retromer. Also required for protein transport from the Golgi apparatus to the endosomes. Promotes neuronal apoptosis by mediating endocytosis of the proapoptotic precursor forms of BDNF (proBDNF) and NGFB (proNGFB). Also acts as a receptor for neurotensin. May promote mineralization of the extracellular matrix during osteogenic differentiation by scavenging extracellular LPL. Probably required in adipocytes for the formation of specialized storage vesicles containing the glucose transporter SLC2A4/GLUT4 (GLUT4 storage vesicles, or GSVs). These vesicles provide a stable pool of SLC2A4 and confer increased responsiveness to insulin. May also mediate transport from the endoplasmic reticulum to the Golgi.
See full target information Sortilin

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com