JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB152700

Recombinant Human Spastin protein (GST tag N-Terminus)

Be the first to review this product! Submit a review

|

(1 Publication)

Recombinant Human Spastin protein (GST tag N-Terminus) is a Human Fragment protein, in the 200 to 304 aa range, expressed in Wheat germ, suitable for SDS-PAGE, ELISA, WB.

View Alternative Names

ADPSP, FSP2, KIAA1083, SPG4, SPAST, Spastin, Spastic paraplegia 4 protein

1 Images
SDS-PAGE - Recombinant Human Spastin protein (GST tag N-Terminus) (AB152700)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human Spastin protein (GST tag N-Terminus) (AB152700)

12.5% SDS-PAGE analysis of ab152700 stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

ELISA, SDS-PAGE, WB

applications

Biologically active

No

Accession

Q9UBP0

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"PVLPFSKSQTDVYNDSTNLACRNGHLQSESGAVPKRKDPLTHTSNSLPRSKTVMKTGSAGLSGHHRAPSYSGLSMVSGVKQGSGPAPTTHKGTPKTNRTNKPSTP","proteinLength":"Fragment","predictedMolecularWeight":"37.29 kDa","actualMolecularWeight":null,"aminoAcidEnd":304,"aminoAcidStart":200,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"Q9UBP0","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Spastin also known as SPG4 is a microtubule-severing ATPase that plays an important role in cellular mechanics by cutting microtubules in cells. It weighs approximately 68 kDa and is present mainly in neural tissue but can also be found in other tissues. The protein's localization includes the cytoplasm and is associated with centrosomes and subcellular regions with dense microtubule networks.
Biological function summary

Spastin participates in regulating microtubule dynamics. It plays a critical role in axonal growth and maintenance by modulating microtubule lengths and branching. Spastin does not function alone; it forms part of the AAA protein family functioning in significant processes like neurogenesis and neural maintenance. Its activity affects neural cell structure and transport by influencing cytoskeletal rearrangement.

Pathways

Any disturbances in Spastin function can impact the microtubule dynamics pathway and the axonal transport pathway. Spastin interacts closely with proteins such as Tubulin and Katanin which are also involved in microtubule severing and organization. Proper Spastin function is necessary to maintain intracellular transport and signal transduction critical for neural cell health and function.

Alterations in Spastin activity lead to neurodegenerative conditions like Hereditary Spastic Paraplegia (HSP). This disorder often relates to mutations in the SPG4 gene which encodes Spastin affecting motor neuron functions. In HSP disrupted Spastin function correlates with deficiencies in proteins such as Tubulin exacerbating neuroaxonal deficits and influencing disease progression.

Specifications

Form

Liquid

General info

Function

ATP-dependent microtubule severing protein that specifically recognizes and cuts microtubules that are polyglutamylated (PubMed : 11809724, PubMed : 15716377, PubMed : 16219033, PubMed : 17389232, PubMed : 20530212, PubMed : 22637577, PubMed : 26875866). Preferentially recognizes and acts on microtubules decorated with short polyglutamate tails : severing activity increases as the number of glutamates per tubulin rises from one to eight, but decreases beyond this glutamylation threshold (PubMed : 26875866). Severing activity is not dependent on tubulin acetylation or detyrosination (PubMed : 26875866). Microtubule severing promotes reorganization of cellular microtubule arrays and the release of microtubules from the centrosome following nucleation. It is critical for the biogenesis and maintenance of complex microtubule arrays in axons, spindles and cilia. SPAST is involved in abscission step of cytokinesis and nuclear envelope reassembly during anaphase in cooperation with the ESCRT-III complex (PubMed : 19000169, PubMed : 21310966, PubMed : 26040712). Recruited at the midbody, probably by IST1, and participates in membrane fission during abscission together with the ESCRT-III complex (PubMed : 21310966). Recruited to the nuclear membrane by IST1 and mediates microtubule severing, promoting nuclear envelope sealing and mitotic spindle disassembly during late anaphase (PubMed : 26040712). Required for membrane traffic from the endoplasmic reticulum (ER) to the Golgi and endosome recycling (PubMed : 23897888). Recruited by IST1 to endosomes and regulates early endosomal tubulation and recycling by mediating microtubule severing (PubMed : 23897888). Probably plays a role in axon growth and the formation of axonal branches (PubMed : 15716377).. Isoform 1. Involved in lipid metabolism by regulating the size and distribution of lipid droplets.

Sequence similarities

Belongs to the AAA ATPase family. Spastin subfamily.

Product protocols

Target data

ATP-dependent microtubule severing protein that specifically recognizes and cuts microtubules that are polyglutamylated (PubMed : 11809724, PubMed : 15716377, PubMed : 16219033, PubMed : 17389232, PubMed : 20530212, PubMed : 22637577, PubMed : 26875866). Preferentially recognizes and acts on microtubules decorated with short polyglutamate tails : severing activity increases as the number of glutamates per tubulin rises from one to eight, but decreases beyond this glutamylation threshold (PubMed : 26875866). Severing activity is not dependent on tubulin acetylation or detyrosination (PubMed : 26875866). Microtubule severing promotes reorganization of cellular microtubule arrays and the release of microtubules from the centrosome following nucleation. It is critical for the biogenesis and maintenance of complex microtubule arrays in axons, spindles and cilia. SPAST is involved in abscission step of cytokinesis and nuclear envelope reassembly during anaphase in cooperation with the ESCRT-III complex (PubMed : 19000169, PubMed : 21310966, PubMed : 26040712). Recruited at the midbody, probably by IST1, and participates in membrane fission during abscission together with the ESCRT-III complex (PubMed : 21310966). Recruited to the nuclear membrane by IST1 and mediates microtubule severing, promoting nuclear envelope sealing and mitotic spindle disassembly during late anaphase (PubMed : 26040712). Required for membrane traffic from the endoplasmic reticulum (ER) to the Golgi and endosome recycling (PubMed : 23897888). Recruited by IST1 to endosomes and regulates early endosomal tubulation and recycling by mediating microtubule severing (PubMed : 23897888). Probably plays a role in axon growth and the formation of axonal branches (PubMed : 15716377).. Isoform 1. Involved in lipid metabolism by regulating the size and distribution of lipid droplets.
See full target information SPAST

Publications (1)

Recent publications for all applications. Explore the full list and refine your search

Neural regeneration research 14:1271-1279 PubMed30804259

2019

Effect of exogenous spastin combined with polyethylene glycol on sciatic nerve injury.

Applications

Unspecified application

Species

Unspecified reactive species

Yao-Fa Lin,Zheng Xie,Jun Zhou,Hui-Hao Chen,Wan-Wan Shao,Hao-Dong Lin
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com