JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB108129

Recombinant Human sRANKL protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human sRANKL protein is a Human Full Length protein, in the 140 to 317 aa range, expressed in Escherichia coli, with >80%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

CD254, OPGL, RANKL, TRANCE, TNFSF11, Tumor necrosis factor ligand superfamily member 11, Osteoclast differentiation factor, Osteoprotegerin ligand, Receptor activator of nuclear factor kappa-B ligand, TNF-related activation-induced cytokine, ODF

1 Images
SDS-PAGE - Recombinant Human sRANKL protein (AB108129)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human sRANKL protein (AB108129)

15% SDS-PAGE analysis of 3µg ab108129.

Key facts

Purity

>80% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE, Mass Spec

applications

Biologically active

No

Accession

O14788

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 20% Glycerol (glycerin, glycerine), 0.58% Sodium chloride, 0.316% Tris HCl, 0.0154% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMIRAEKAMVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSHKVSLSSWYHDRGWAKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLDPDQDATYFGAFKVRDID","proteinLength":"Full Length","predictedMolecularWeight":"22.3 kDa","actualMolecularWeight":null,"aminoAcidEnd":317,"aminoAcidStart":140,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"O14788","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

SRANKL also known as soluble receptor activator of nuclear factor kappa-B ligand is an essential protein involved in bone metabolism. It acts as a cytokine and is a member of the tumor necrosis factor (TNF) superfamily. sRANKL is derived from the membrane-bound form of RANKL by proteolytic cleavage and has a molecular weight of approximately 18 kDa. This protein is predominantly found in osteoblasts osteocytes and T-cells where it plays a critical role in physiological processes.
Biological function summary

SRANKL facilitates the differentiation and activation of osteoclasts which are cells responsible for bone resorption. It binds to its receptor RANK on osteoclast precursors promoting their maturation into fully functional osteoclasts. This binding process involves complex formation and interaction with another molecule called osteoprotegerin (OPG) which acts as a decoy receptor regulating sRANKL activity and therefore controlling bone resorption.

Pathways

SRANKL plays a fundamental role in the RANK/RANKL/OPG signaling pathway which is important for maintaining bone homeostasis. This pathway regulates the balance between bone formation and resorption. It also interacts with NF-kappaB signaling a pathway that influences inflammation and immune response. sRANKL through these pathways closely connects with proteins such as TRAF6 which mediates downstream signaling leading to osteoclastogenesis.

Alterations in the sRANKL pathway impact bone-related diseases such as osteoporosis and rheumatoid arthritis. In osteoporosis increased levels of sRANKL enhance osteoclast activity leading to excessive bone resorption and thereby weakening bones. In rheumatoid arthritis the interaction between sRANKL and RANK promotes inflammation and joint destruction. This protein is linked to OPG as variations in their ratio influence disease development and progression.

Specifications

Form

Liquid

Additional notes

ab108129 was purified using conventional chromatography.

General info

Function

Cytokine that binds to TNFRSF11B/OPG and to TNFRSF11A/RANK. Osteoclast differentiation and activation factor. Augments the ability of dendritic cells to stimulate naive T-cell proliferation. May be an important regulator of interactions between T-cells and dendritic cells and may play a role in the regulation of the T-cell-dependent immune response. May also play an important role in enhanced bone-resorption in humoral hypercalcemia of malignancy (PubMed : 22664871). Induces osteoclastogenesis by activating multiple signaling pathways in osteoclast precursor cells, chief among which is induction of long lasting oscillations in the intracellular concentration of Ca (2+) resulting in the activation of NFATC1, which translocates to the nucleus and induces osteoclast-specific gene transcription to allow differentiation of osteoclasts. During osteoclast differentiation, in a TMEM64 and ATP2A2-dependent manner induces activation of CREB1 and mitochondrial ROS generation necessary for proper osteoclast generation (By similarity).

Sequence similarities

Belongs to the tumor necrosis factor family.

Post-translational modifications

The soluble form of isoform 1 derives from the membrane form by proteolytic processing (By similarity). The cleavage may be catalyzed by ADAM17.

Product protocols

Target data

Cytokine that binds to TNFRSF11B/OPG and to TNFRSF11A/RANK. Osteoclast differentiation and activation factor. Augments the ability of dendritic cells to stimulate naive T-cell proliferation. May be an important regulator of interactions between T-cells and dendritic cells and may play a role in the regulation of the T-cell-dependent immune response. May also play an important role in enhanced bone-resorption in humoral hypercalcemia of malignancy (PubMed : 22664871). Induces osteoclastogenesis by activating multiple signaling pathways in osteoclast precursor cells, chief among which is induction of long lasting oscillations in the intracellular concentration of Ca (2+) resulting in the activation of NFATC1, which translocates to the nucleus and induces osteoclast-specific gene transcription to allow differentiation of osteoclasts. During osteoclast differentiation, in a TMEM64 and ATP2A2-dependent manner induces activation of CREB1 and mitochondrial ROS generation necessary for proper osteoclast generation (By similarity).
See full target information TNFSF11

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com