JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB159577

Recombinant Human SREBP1 protein (GST tag N-Terminus)

Be the first to review this product! Submit a review

|

(1 Publication)

Recombinant Human SREBP1 protein (GST tag N-Terminus) is a Human Fragment protein, in the 801 to 900 aa range, expressed in Wheat germ, suitable for ELISA, WB.

View Alternative Names

BHLHD1, SREBP1, SREBF1, Sterol regulatory element-binding protein 1, SREBP-1, Class D basic helix-loop-helix protein 1, Sterol regulatory element-binding transcription factor 1, bHLHd1

1 Images
SDS-PAGE - Recombinant Human SREBP1 protein (GST tag N-Terminus) (AB159577)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human SREBP1 protein (GST tag N-Terminus) (AB159577)

ab159577 on a 12.5% SDS-PAGE stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

WB, ELISA

applications

Biologically active

No

Accession

P36956

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"VTQLFREHLLERALNCVTQPNPSPGSADGDKEFSDALGYLQLLNSCSDAAGAPAYSFSISSSMATTTGVDPVAKWWASLTAVVIHWLRRDEEAAERLCPL","proteinLength":"Fragment","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":900,"aminoAcidStart":801,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"P36956","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Specifications

Form

Liquid

General info

Function

Sterol regulatory element-binding protein 1. Precursor of the transcription factor form (Processed sterol regulatory element-binding protein 1), which is embedded in the endoplasmic reticulum membrane (PubMed : 32322062). Low sterol concentrations promote processing of this form, releasing the transcription factor form that translocates into the nucleus and activates transcription of genes involved in cholesterol biosynthesis and lipid homeostasis (By similarity).. Processed sterol regulatory element-binding protein 1. Key transcription factor that regulates expression of genes involved in cholesterol biosynthesis and lipid homeostasis (PubMed : 12177166, PubMed : 32322062, PubMed : 8402897). Binds to the sterol regulatory element 1 (SRE-1) (5'-ATCACCCCAC-3'). Has dual sequence specificity binding to both an E-box motif (5'-ATCACGTGA-3') and to SRE-1 (5'-ATCACCCCAC-3') (PubMed : 12177166, PubMed : 8402897). Regulates the promoters of genes involved in cholesterol biosynthesis and the LDL receptor (LDLR) pathway of sterol regulation (PubMed : 12177166, PubMed : 32322062, PubMed : 8402897).. Isoform SREBP-1A. Isoform expressed only in select tissues, which has higher transcriptional activity compared to SREBP-1C (By similarity). Able to stimulate both lipogenic and cholesterogenic gene expression (PubMed : 12177166, PubMed : 32497488). Has a role in the nutritional regulation of fatty acids and triglycerides in lipogenic organs such as the liver (By similarity). Required for innate immune response in macrophages by regulating lipid metabolism (By similarity).. Isoform SREBP-1C. Predominant isoform expressed in most tissues, which has weaker transcriptional activity compared to isoform SREBP-1A (By similarity). Primarily controls expression of lipogenic gene (PubMed : 12177166). Strongly activates global lipid synthesis in rapidly growing cells (By similarity).. Isoform SREBP-1aDelta. The absence of Golgi proteolytic processing requirement makes this isoform constitutively active in transactivation of lipogenic gene promoters.. Isoform SREBP-1cDelta. The absence of Golgi proteolytic processing requirement makes this isoform constitutively active in transactivation of lipogenic gene promoters.

Sequence similarities

Belongs to the SREBP family.

Post-translational modifications

Sterol regulatory element-binding protein 1. Processed in the Golgi apparatus, releasing the protein from the membrane (PubMed:32322062, PubMed:8626610). At low cholesterol the SCAP-SREBP complex is recruited into COPII vesicles for export from the endoplasmic reticulum (PubMed:32322062, PubMed:8626610). In the Golgi, complex SREBPs are cleaved sequentially by site-1 (MBTPS1, S1P) and site-2 (MBTPS2, S2P) protease (PubMed:32322062, PubMed:8626610). The first cleavage by site-1 protease occurs within the luminal loop, the second cleavage by site-2 protease occurs within the first transmembrane domain, releasing the transcription factor from the Golgi membrane (PubMed:32322062).. Phosphorylated by AMPK, leading to suppress protein processing and nuclear translocation, and repress target gene expression (By similarity). Phosphorylation at Ser-402 by SIK1 represses activity possibly by inhibiting DNA-binding (By similarity).. Processed sterol regulatory element-binding protein 1. Ubiquitinated; the nuclear form has a rapid turnover and is rapidly ubiquitinated and degraded by the proteasome in the nucleus.

Subcellular localisation

Nucleus

Product protocols

Target data

Sterol regulatory element-binding protein 1. Precursor of the transcription factor form (Processed sterol regulatory element-binding protein 1), which is embedded in the endoplasmic reticulum membrane (PubMed : 32322062). Low sterol concentrations promote processing of this form, releasing the transcription factor form that translocates into the nucleus and activates transcription of genes involved in cholesterol biosynthesis and lipid homeostasis (By similarity).. Processed sterol regulatory element-binding protein 1. Key transcription factor that regulates expression of genes involved in cholesterol biosynthesis and lipid homeostasis (PubMed : 12177166, PubMed : 32322062, PubMed : 8402897). Binds to the sterol regulatory element 1 (SRE-1) (5'-ATCACCCCAC-3'). Has dual sequence specificity binding to both an E-box motif (5'-ATCACGTGA-3') and to SRE-1 (5'-ATCACCCCAC-3') (PubMed : 12177166, PubMed : 8402897). Regulates the promoters of genes involved in cholesterol biosynthesis and the LDL receptor (LDLR) pathway of sterol regulation (PubMed : 12177166, PubMed : 32322062, PubMed : 8402897).. Isoform SREBP-1A. Isoform expressed only in select tissues, which has higher transcriptional activity compared to SREBP-1C (By similarity). Able to stimulate both lipogenic and cholesterogenic gene expression (PubMed : 12177166, PubMed : 32497488). Has a role in the nutritional regulation of fatty acids and triglycerides in lipogenic organs such as the liver (By similarity). Required for innate immune response in macrophages by regulating lipid metabolism (By similarity).. Isoform SREBP-1C. Predominant isoform expressed in most tissues, which has weaker transcriptional activity compared to isoform SREBP-1A (By similarity). Primarily controls expression of lipogenic gene (PubMed : 12177166). Strongly activates global lipid synthesis in rapidly growing cells (By similarity).. Isoform SREBP-1aDelta. The absence of Golgi proteolytic processing requirement makes this isoform constitutively active in transactivation of lipogenic gene promoters.. Isoform SREBP-1cDelta. The absence of Golgi proteolytic processing requirement makes this isoform constitutively active in transactivation of lipogenic gene promoters.
See full target information SREBF1

Publications (1)

Recent publications for all applications. Explore the full list and refine your search

Cell death & disease 14:182 PubMed36878903

2023

USP7- and PRMT5-dependent G3BP2 stabilization drives de novo lipogenesis and tumorigenesis of HNSC.

Applications

Unspecified application

Species

Unspecified reactive species

Nan Wang,Tianzi Li,Wanyu Liu,Jinhua Lin,Ke Zhang,Zhenhao Li,Yanfei Huang,Yufei Shi,Meilan Xu,Xuekui Liu
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com