JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB316068

Recombinant Human SSTR2 (Active) protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human SSTR2 (Active) protein is a Human Full Length protein, in the 1 to 369 aa range, expressed in HEK 293 cells, with >95%, < 1 EU/µg endotoxin level, suitable for FuncS.

View Alternative Names

Somatostatin receptor type 2, SS-2-R, SS2-R, SS2R, SST2, SRIF-1, SSTR2

Key facts

Purity

>95% HPLC

Endotoxin level

< 1 EU/µg

Expression system

HEK 293 cells

Tags

Tag free

Applications

FuncS

applications

Biologically active

Yes

Biological activity

Immobilized Human SSTR2 VLP at 5ug/ml on the plate (100ul/Well). Dose response curve for Anti-SSTR2 Antibody, hFc Tag with the EC50 of 32.8ng/ml determined by ELISA.

Accession

P30874

Animal free

No

Carrier free

Yes

Species

Human

Storage buffer

Constituents: PBS

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MDMADEPLNGSHTWLSIPFDLNGSVVSTNTSNQTEPYYDLTSNAVLTFIYFVVCIIGLCGNTLVIYVILRYAKMKTITNIYILNLAIADELFMLGLPFLAMQVALVHWPFGKAICRVVMTVDGINQFTSIFCLTVMSIDRYLAVVHPIKSAKWRRPRTAKMITMAVWGVSLLVILPIMIYAGLRSNQWGRSSCTINWPGESGAWYTGFIIYTFILGFLVPLTIICLCYLFIIIKVKSSGIRVGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSVSMAISPTPALKGMFDFVVVLTYANSCANPILYAFLSDNFKKSFQNVLCLVKVSGTDDGERSDSKQDKSRLNETTETQRTLLNGDLQTSI","proteinLength":"Full Length","predictedMolecularWeight":"42.7 kDa","actualMolecularWeight":null,"aminoAcidEnd":369,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"P30874","tags":[]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The somatostatin receptor 2 (SSTR2) also known as SS2R serves as a G protein-coupled receptor with a molecular mass of approximately 40-60 kDa. SSTR2 specifically binds somatostatin a peptide hormone that regulates the endocrine system neurotransmission and cell proliferation via interaction with various somatostatin receptors. Scientists find SSTR2 expressed in high levels in the pituitary gland central nervous system gastrointestinal tract and pancreatic cells.
Biological function summary

Somatostatin receptor 2 mediates the inhibitory effects of somatostatin on cell growth and the release of other hormones. It functions as part of the receptor complex modulating intracellular signaling pathways. SSTR2 often interacts closely with other molecules like G proteins to inhibit adenylyl cyclase reducing cyclic AMP (cAMP) levels and influencing diverse cellular responses. The receptor's ability to influence such processes emphasizes its role in maintaining cellular and systemic homeostasis.

Pathways

Somatostatin receptor 2 plays an important role in the inhibitory signaling pathways related to growth hormone regulation and neurotransmitter release. SSTR2 actively participates in the somatostatin signaling pathway intimately interacting with proteins such as adenylate cyclase and phospholipase C. Another important pathway includes the regulation of the MAPK pathway serving to modulate cell proliferation and survival reiterating its regulatory function within endocrine signaling and cellular communication.

Somatostatin receptor 2 demonstrates significant involvement in neuroendocrine tumors and acromegaly. The overexpression of SSTR2 in neuroendocrine tumors provides a valuable target for diagnostic imaging and therapeutic interventions using somatostatin analogs. In acromegaly where excess growth hormone production occurs SSTR2's modulation of growth hormone release becomes important; it often works alongside growth hormone receptors and IGF-1 to limit abnormal growth. Therefore the receptor's targeting offers therapeutic potential and advances disease understanding.

Specifications

Form

Liquid

General info

Function

Receptor for somatostatin-14 and -28. This receptor is coupled via pertussis toxin sensitive G proteins to inhibition of adenylyl cyclase. In addition it stimulates phosphotyrosine phosphatase and PLC via pertussis toxin insensitive as well as sensitive G proteins. Inhibits calcium entry by suppressing voltage-dependent calcium channels. Acts as the functionally dominant somatostatin receptor in pancreatic alpha- and beta-cells where it mediates the inhibitory effect of somatostatin-14 on hormone secretion. Inhibits cell growth through enhancement of MAPK1 and MAPK2 phosphorylation and subsequent up-regulation of CDKN1B. Stimulates neuronal migration and axon outgrowth and may participate in neuron development and maturation during brain development. Mediates negative regulation of insulin receptor signaling through PTPN6. Inactivates SSTR3 receptor function following heterodimerization.

Sequence similarities

Belongs to the G-protein coupled receptor 1 family.

Post-translational modifications

Phosphorylated on serine and threonine residues in response to agonist stimulation, leading to receptor desensitization and rapid internalization. Phosphorylated to a greater extent on serine than threonine residues. Threonine phosphorylation is required for arrestin binding and receptor endocytosis but is not necessary for desensitization (By similarity).

Product protocols

Target data

Receptor for somatostatin-14 and -28. This receptor is coupled via pertussis toxin sensitive G proteins to inhibition of adenylyl cyclase. In addition it stimulates phosphotyrosine phosphatase and PLC via pertussis toxin insensitive as well as sensitive G proteins. Inhibits calcium entry by suppressing voltage-dependent calcium channels. Acts as the functionally dominant somatostatin receptor in pancreatic alpha- and beta-cells where it mediates the inhibitory effect of somatostatin-14 on hormone secretion. Inhibits cell growth through enhancement of MAPK1 and MAPK2 phosphorylation and subsequent up-regulation of CDKN1B. Stimulates neuronal migration and axon outgrowth and may participate in neuron development and maturation during brain development. Mediates negative regulation of insulin receptor signaling through PTPN6. Inactivates SSTR3 receptor function following heterodimerization.
See full target information SSTR2

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com