JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB219662

Recombinant human ST2 protein (Fc Chimera Active)

Be the first to review this product! Submit a review

|

(1 Publication)

Recombinant human ST2 protein (Fc Chimera Active) is a Human Fragment protein, in the 19 to 323 aa range, expressed in HEK 293 cells, with >90%, < 1 EU/µg endotoxin level, suitable for FuncS, SDS-PAGE.

View Alternative Names

DER4, ST2, T1, IL1RL1, Interleukin-1 receptor-like 1, Protein ST2

2 Images
Functional Studies - Recombinant human ST2 protein (Fc Chimera Active) (AB219662)
  • FuncS

Supplier Data

Functional Studies - Recombinant human ST2 protein (Fc Chimera Active) (AB219662)

Immobilized Human IL-33, Tag Free at 5 μg/mL (100 μL/well) can bind ab219662 with a linear range of 1.95-7.8 ng/mL.

SDS-PAGE - Recombinant human ST2 protein (Fc Chimera Active) (AB219662)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant human ST2 protein (Fc Chimera Active) (AB219662)

SDS-PAGE using ab219662. Migrates at 85-100 kDa under reducing conditions due to glycosylation.

Key facts

Purity

>90% SDS-PAGE

Endotoxin level

< 1 EU/µg

Expression system

HEK 293 cells

Tags

Fc tag C-Terminus

Applications

SDS-PAGE, FuncS

applications

Biologically active

Yes

Biological activity

Immobilized Human IL-33, Tag Free at 5 μg/mL (100 μL/well) can bind ab219662 with a linear range of 1.95-7.8 ng/mL.

Accession

Q01638

Animal free

No

Carrier free

No

Species

Human

Reconstitution

Reconstitute at 200 µg/mL in water

Storage buffer

pH: 7.4 Constituents: L-Arginine, Sodium chloride, 5% Trehalose, 0.75% Glycine, 0.61% Tris

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p>The protein migrates as 85-100 kDa on a SDS-PAGE gel under reducing (R) conditions due to glycosylation.</p>" } } }

Sequence info

[{"sequence":"KFSKQSWGLENEALIVRCPRQGKPSYTVDWYYSQTNKSIPTQERNRVFASGQLLKFLPAAVADSGIYTCIVRSPTFNRTGYANVTIYKKQSDCNVPDYLMYSTVSGSEKNSKIYCPTIDLYNWTAPLEWFKNCQALQGSRYRAHKSFLVIDNVMTEDAGDYTCKFIHNENGANYSVTATRSFTVKDEQGFSLFPVIGAPAQNEIKEVEIGKNANLTCSACFGKGTQFLAAVLWQLNGTKITDFGEPRIQQEEGQNQSFSNGLACLDMVLRIADVKEEDLLLQYDCLALNLHGLRRHTVRLSRKNP","proteinLength":"Fragment","predictedMolecularWeight":"61 kDa","actualMolecularWeight":null,"aminoAcidEnd":323,"aminoAcidStart":19,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"Q01638","tags":[{"tag":"Fc","terminus":"C-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
For long term storage it is recommended to add a carrier protein on reconstitution (0.1% HSA or BSA)
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

ST2 also known as IL-1RL1 or IL-1RL1 chimera protein is a member of the IL-1 receptor family. It has a molecular mass of approximately 55 kDa. This protein exists in different forms including a membrane-bound form and a soluble variant. Researchers typically find ST2 expressed in various tissues including the lungs gut and cardiovascular system. The expression level can vary significantly depending on the physiological or pathological state.
Biological function summary

ST2 interacts with interleukin-33 (IL-33) and functions as its receptor. The binding of IL-33 to ST2 activates immune responses particularly influencing T-helper 2 (Th2) cells. ST2 forms part of a receptor complex including IL-1 receptor accessory protein IL-1RAcP necessary for signal transduction. This interaction leads to the activation of nuclear factor kappa-light-chain-enhancer of activated B cells (NF-kB) and mitogen-activated protein kinase (MAPK) signaling pathways facilitating inflammatory responses.

Pathways

IL-33 signals through the ST2 receptor participating actively in the immune signaling pathway. This pathway plays a significant role in modulating inflammatory and immune responses. ST2 association with NF-kB broadly affects inflammatory signaling while its involvement with the MAPK pathway aids in cellular responses to cytokines and stress. The close relationship with the IL-33/ST2 axis highlights its importance in maintaining immune homeostasis and reacting to environmental stressors.

ST2 has significant associations with asthma and cardiovascular diseases. In asthma the IL-33/ST2 axis critically contributes to airway inflammation and hyperresponsiveness. Similarly in the context of cardiovascular diseases elevated levels of soluble ST2 are markers of heart failure with the ST2/IL-33 axis contributing to cardiac remodeling. ST2's connection with inflammatory processes implies it also interacts with other cytokines such as interleukin-6 (IL-6) exacerbating the disease states through shared pathways.

Specifications

Form

Lyophilized

General info

Function

Receptor for interleukin-33 (IL-33) which plays crucial roles in innate and adaptive immunity, contributing to tissue homeostasis and responses to environmental stresses together with coreceptor IL1RAP (PubMed : 35238669). Its stimulation recruits MYD88, IRAK1, IRAK4, and TRAF6, followed by phosphorylation of MAPK3/ERK1 and/or MAPK1/ERK2, MAPK14, and MAPK8. Possibly involved in helper T-cell function (Probable) (PubMed : 16286016). Upon tissue injury, induces UCP2-dependent mitochondrial rewiring that attenuates the generation of reactive oxygen species and preserves the integrity of Krebs cycle required for persistent production of itaconate and subsequent GATA3-dependent differentiation of inflammation-resolving alternatively activated macrophages (By similarity).. Isoform B. Inhibits IL-33 signaling.

Sequence similarities

Belongs to the interleukin-1 receptor family.

Post-translational modifications

Ubiquitinated at Lys-321 in a FBXL19-mediated manner; leading to proteasomal degradation. Ubiquitination by TRAF6 via 'Lys-27'-linked polyubiquitination and deubiquitination by USP38 serves as a critical regulatory mechanism for fine-tuning IL1RL1-mediated inflammatory response (PubMed:35238669).

Product protocols

Target data

Receptor for interleukin-33 (IL-33) which plays crucial roles in innate and adaptive immunity, contributing to tissue homeostasis and responses to environmental stresses together with coreceptor IL1RAP (PubMed : 35238669). Its stimulation recruits MYD88, IRAK1, IRAK4, and TRAF6, followed by phosphorylation of MAPK3/ERK1 and/or MAPK1/ERK2, MAPK14, and MAPK8. Possibly involved in helper T-cell function (Probable) (PubMed : 16286016). Upon tissue injury, induces UCP2-dependent mitochondrial rewiring that attenuates the generation of reactive oxygen species and preserves the integrity of Krebs cycle required for persistent production of itaconate and subsequent GATA3-dependent differentiation of inflammation-resolving alternatively activated macrophages (By similarity).. Isoform B. Inhibits IL-33 signaling.
See full target information IL1RL1

Publications (1)

Recent publications for all applications. Explore the full list and refine your search

Cell cycle (Georgetown, Tex.) 19:1132-1142 PubMed32298206

2020

Epithelial cells expressed IL-33 to promote degranulation of mast cells through inhibition on ST2/PI3K/mTOR-mediated autophagy in allergic rhinitis.

Applications

Unspecified application

Species

Unspecified reactive species

Jia-Bin Nian,Min Zeng,Jing Zheng,Lian-Ya Zeng,Zhi Fu,Qiu-Ju Huang,Xin Wei
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com