JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB82791

Recombinant Human STUB1/CHIP protein

Be the first to review this product! Submit a review

|

(2 Publications)

Recombinant Human STUB1/CHIP protein is a Human Full Length protein, in the 1 to 303 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE, WB.

View Alternative Names

CHIP, PP1131, STUB1, E3 ubiquitin-protein ligase CHIP, Antigen NY-CO-7, CLL-associated antigen KW-8, Carboxy terminus of Hsp70-interacting protein, RING-type E3 ubiquitin transferase CHIP, STIP1 homology and U box-containing protein 1

2 Images
Western blot - Recombinant Human STUB1/CHIP protein (AB82791)
  • WB

Unknown

Western blot - Recombinant Human STUB1/CHIP protein (AB82791)

All lanes:

Western blot - Anti-STUB1/CHIP antibody (<a href='/en-us/products/primary-antibodies/stub1-chip-antibody-ab2917'>ab2917</a>) at 1/1000 dilution

All lanes:

Western blot - Recombinant Human STUB1/CHIP protein (ab82791) at 0.01 µg

Secondary

All lanes:

Western blot - Goat Anti-Rabbit IgG H&L (HRP) preadsorbed (<a href='/en-us/products/secondary-antibodies/goat-rabbit-igg-h-l-hrp-preadsorbed-ab97080'>ab97080</a>) at 1/5000 dilution

Predicted band size: 35 kDa

true

Exposure time: 2min

SDS-PAGE - Recombinant Human STUB1/CHIP protein (AB82791)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human STUB1/CHIP protein (AB82791)

15% SDS-PAGE showing ab82791 at approximately 34.8kDa (3μg).

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

Tag free

Applications

SDS-PAGE, WB

applications

Biologically active

No

Accession

Q9UNE7

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.5 Constituents: 10% Glycerol (glycerin, glycerine), 0.316% Tris HCl, 0.077% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p>ab82791 can be used as a WB positive control in conjunction with <a href='/en-us/products/primary-antibodies/stub1-chip-antibody-ab2917'>ab2917</a>.</p>" } } }

Product details

Previously labelled as STUB1.

Sequence info

[{"sequence":"MKGKEEKEGGARLGAGGGSPEKSPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQHEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNSIEERRIHQESELHSYLSRLIAAERERELEECQRNHEGDEDDSHVRAQQACIEAKHDKYMADMDELFSQVDEKRKKRDIPDYLCGKISFELMREPCITPSGITYDRKDIEEHLQRVGHFDPVTRSPLTQEQLIPNLAMKEVIDAFISENGWVEDY","proteinLength":"Full Length","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":303,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q9UNE7","tags":[]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

STUB1 also known as CHIP (C-Terminal of Hsc70 Interacting Protein) is a protein with a molecular mass of approximately 35 kDa. It has ubiquitin ligase activity and functions as a co-chaperone. STUB1 interacts with chaperone proteins such as Hsp70 and Hsp90 modulating their activity. You can observe STUB1 expression in various tissues with higher levels found in the brain heart and skeletal muscle.
Biological function summary

STUB1 plays an important role in protein quality control by targeting misfolded or damaged proteins for degradation. It forms a complex with chaperone proteins Hsp70 and Hsp90 facilitating the ubiquitination process. This helps maintain cellular proteostasis. STUB1 has a critical role in preventing protein aggregation which is important in stress responses and normal cellular function.

Pathways

STUB1 has significant involvement in the protein degradation pathway and the heat shock response pathway. It works closely with proteasome-associated proteins to ensure proteostasis. In these pathways STUB1 interacts with other proteins such as Hsc70 and Hsp70 which assist in protein folding and stability under stress conditions.

STUB1 has links to neurodegenerative diseases and cancer. A dysfunction in STUB1 can lead to protein aggregation a hallmark of neurodegenerative conditions like Alzheimer's disease. In certain cancers altered STUB1 expression might affect cell survival pathways with related proteins including Hsp70 and Hsp90. Therapeutic strategies that modulate STUB1 and its interactions may provide avenues for disease intervention.

Specifications

Form

Liquid

General info

Function

E3 ubiquitin-protein ligase which targets misfolded chaperone substrates towards proteasomal degradation (PubMed : 10330192, PubMed : 11146632, PubMed : 11557750, PubMed : 23990462, PubMed : 26265139). Plays a role in the maintenance of mitochondrial morphology and promotes mitophagic removal of dysfunctional mitochondria; thereby acts as a protector against apoptosis in response to cellular stress (By similarity). Negatively regulates vascular smooth muscle contraction, via degradation of the transcriptional activator MYOCD and subsequent loss of transcription of genes involved in vascular smooth muscle contraction (By similarity). Promotes survival and proliferation of cardiac smooth muscle cells via ubiquitination and degradation of FOXO1, resulting in subsequent repression of FOXO1-mediated transcription of pro-apoptotic genes (PubMed : 19483080). Ubiquitinates ICER-type isoforms of CREM and targets them for proteasomal degradation, thereby acts as a positive effector of MAPK/ERK-mediated inhibition of apoptosis in cardiomyocytes (PubMed : 20724525). Inhibits lipopolysaccharide-induced apoptosis and hypertrophy in cardiomyocytes, via ubiquitination and subsequent proteasomal degradation of NFATC3 (PubMed : 30980393). Collaborates with ATXN3 in the degradation of misfolded chaperone substrates : ATXN3 restricting the length of ubiquitin chain attached to STUB1/CHIP substrates and preventing further chain extension (PubMed : 10330192, PubMed : 11146632, PubMed : 11557750, PubMed : 23990462). Ubiquitinates NOS1 in concert with Hsp70 and Hsp40 (PubMed : 15466472). Modulates the activity of several chaperone complexes, including Hsp70, Hsc70 and Hsp90 (PubMed : 10330192, PubMed : 11146632, PubMed : 15466472). Ubiquitinates CHRNA3 targeting it for endoplasmic reticulum-associated degradation in cortical neurons, as part of the STUB1-VCP-UBXN2A complex (PubMed : 26265139). Ubiquitinates and promotes ESR1 proteasomal degradation in response to age-related circulating estradiol (17-beta-estradiol/E2) decline, thereby promotes neuronal apoptosis in response to ischemic reperfusion injury (By similarity). Mediates transfer of non-canonical short ubiquitin chains to HSPA8 that have no effect on HSPA8 degradation (PubMed : 11557750, PubMed : 23990462). Mediates polyubiquitination of DNA polymerase beta (POLB) at 'Lys-41', 'Lys-61' and 'Lys-81', thereby playing a role in base-excision repair : catalyzes polyubiquitination by amplifying the HUWE1/ARF-BP1-dependent monoubiquitination and leading to POLB-degradation by the proteasome (PubMed : 19713937). Mediates polyubiquitination of CYP3A4 (PubMed : 19103148). Ubiquitinates EPHA2 and may regulate the receptor stability and activity through proteasomal degradation (PubMed : 19567782). Acts as a co-chaperone for HSPA1A and HSPA1B chaperone proteins and promotes ubiquitin-mediated protein degradation (PubMed : 27708256). Negatively regulates the suppressive function of regulatory T-cells (Treg) during inflammation by mediating the ubiquitination and degradation of FOXP3 in a HSPA1A/B-dependent manner (PubMed : 23973223). Catalyzes monoubiquitination of SIRT6, preventing its degradation by the proteasome (PubMed : 24043303). Likely mediates polyubiquitination and down-regulates plasma membrane expression of PD-L1/CD274, an immune inhibitory ligand critical for immune tolerance to self and antitumor immunity (PubMed : 28813410). Negatively regulates TGF-beta signaling by modulating the basal level of SMAD3 via ubiquitin-mediated degradation (PubMed : 24613385). Plays a role in the degradation of TP53 (PubMed : 26634371). Mediates ubiquitination of RIPK3 leading to its subsequent proteasome-dependent degradation (PubMed : 29883609). May regulate myosin assembly in striated muscles together with UBE4B and VCP/p97 by targeting myosin chaperone UNC45B for proteasomal degradation (PubMed : 17369820). Ubiquitinates PPARG in macrophages playing a role in M2 macrophages polarization and angiogenesis (By similarity).

Post-translational modifications

Monoubiquitinated at Lys-2 following cell stress by UBE2W, promoting the interaction with ATXN3 (By similarity). Auto-ubiquitinated; mediated by UBE2D1 and UBE2D2 and enhanced in the presence of MAP2K5 (PubMed:20724525).

Subcellular localisation

Nucleus

Product protocols

Target data

E3 ubiquitin-protein ligase which targets misfolded chaperone substrates towards proteasomal degradation (PubMed : 10330192, PubMed : 11146632, PubMed : 11557750, PubMed : 23990462, PubMed : 26265139). Plays a role in the maintenance of mitochondrial morphology and promotes mitophagic removal of dysfunctional mitochondria; thereby acts as a protector against apoptosis in response to cellular stress (By similarity). Negatively regulates vascular smooth muscle contraction, via degradation of the transcriptional activator MYOCD and subsequent loss of transcription of genes involved in vascular smooth muscle contraction (By similarity). Promotes survival and proliferation of cardiac smooth muscle cells via ubiquitination and degradation of FOXO1, resulting in subsequent repression of FOXO1-mediated transcription of pro-apoptotic genes (PubMed : 19483080). Ubiquitinates ICER-type isoforms of CREM and targets them for proteasomal degradation, thereby acts as a positive effector of MAPK/ERK-mediated inhibition of apoptosis in cardiomyocytes (PubMed : 20724525). Inhibits lipopolysaccharide-induced apoptosis and hypertrophy in cardiomyocytes, via ubiquitination and subsequent proteasomal degradation of NFATC3 (PubMed : 30980393). Collaborates with ATXN3 in the degradation of misfolded chaperone substrates : ATXN3 restricting the length of ubiquitin chain attached to STUB1/CHIP substrates and preventing further chain extension (PubMed : 10330192, PubMed : 11146632, PubMed : 11557750, PubMed : 23990462). Ubiquitinates NOS1 in concert with Hsp70 and Hsp40 (PubMed : 15466472). Modulates the activity of several chaperone complexes, including Hsp70, Hsc70 and Hsp90 (PubMed : 10330192, PubMed : 11146632, PubMed : 15466472). Ubiquitinates CHRNA3 targeting it for endoplasmic reticulum-associated degradation in cortical neurons, as part of the STUB1-VCP-UBXN2A complex (PubMed : 26265139). Ubiquitinates and promotes ESR1 proteasomal degradation in response to age-related circulating estradiol (17-beta-estradiol/E2) decline, thereby promotes neuronal apoptosis in response to ischemic reperfusion injury (By similarity). Mediates transfer of non-canonical short ubiquitin chains to HSPA8 that have no effect on HSPA8 degradation (PubMed : 11557750, PubMed : 23990462). Mediates polyubiquitination of DNA polymerase beta (POLB) at 'Lys-41', 'Lys-61' and 'Lys-81', thereby playing a role in base-excision repair : catalyzes polyubiquitination by amplifying the HUWE1/ARF-BP1-dependent monoubiquitination and leading to POLB-degradation by the proteasome (PubMed : 19713937). Mediates polyubiquitination of CYP3A4 (PubMed : 19103148). Ubiquitinates EPHA2 and may regulate the receptor stability and activity through proteasomal degradation (PubMed : 19567782). Acts as a co-chaperone for HSPA1A and HSPA1B chaperone proteins and promotes ubiquitin-mediated protein degradation (PubMed : 27708256). Negatively regulates the suppressive function of regulatory T-cells (Treg) during inflammation by mediating the ubiquitination and degradation of FOXP3 in a HSPA1A/B-dependent manner (PubMed : 23973223). Catalyzes monoubiquitination of SIRT6, preventing its degradation by the proteasome (PubMed : 24043303). Likely mediates polyubiquitination and down-regulates plasma membrane expression of PD-L1/CD274, an immune inhibitory ligand critical for immune tolerance to self and antitumor immunity (PubMed : 28813410). Negatively regulates TGF-beta signaling by modulating the basal level of SMAD3 via ubiquitin-mediated degradation (PubMed : 24613385). Plays a role in the degradation of TP53 (PubMed : 26634371). Mediates ubiquitination of RIPK3 leading to its subsequent proteasome-dependent degradation (PubMed : 29883609). May regulate myosin assembly in striated muscles together with UBE4B and VCP/p97 by targeting myosin chaperone UNC45B for proteasomal degradation (PubMed : 17369820). Ubiquitinates PPARG in macrophages playing a role in M2 macrophages polarization and angiogenesis (By similarity).
See full target information STUB1

Publications (2)

Recent publications for all applications. Explore the full list and refine your search

Cellular & molecular immunology 21:510-526 PubMed38472357

2024

Neutrophil ALDH2 is a new therapeutic target for the effective treatment of sepsis-induced ARDS.

Applications

Unspecified application

Species

Unspecified reactive species

Changchang Xu,Lin Zhang,Shaoyu Xu,Zichen Wang,Qi Han,Ying Lv,Xingfang Wang,Xiangxin Zhang,Qingju Zhang,Ying Zhang,Simeng He,Qiuhuan Yuan,Yuan Bian,Chuanbao Li,Jiali Wang,Feng Xu,Yihai Cao,Jiaojiao Pang,Yuguo Chen

FASEB journal : official publication of the Federation of American Societies for Experimental Biology 30:564-77 PubMed26443817

2015

Chaperome screening leads to identification of Grp94/Gp96 and FKBP4/52 as modulators of the α-synuclein-elicited immune response.

Applications

Unspecified application

Species

Unspecified reactive species

Adahir Labrador-Garrido,Marta Cejudo-Guillén,Soumya Daturpalli,María M Leal,Rebecca Klippstein,Erwin J De Genst,Javier Villadiego,Juan J Toledo-Aral,Christopher M Dobson,Sophie E Jackson,David Pozo,Cintia Roodveldt
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com