JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB171699

Recombinant Human STX17 protein (His tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human STX17 protein (His tag N-Terminus) is a Human Fragment protein, in the 1 to 229 aa range, expressed in Escherichia coli, with >85%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

Syntaxin-17, STX17

1 Images
SDS-PAGE - Recombinant Human STX17 protein (His tag N-Terminus) (AB171699)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human STX17 protein (His tag N-Terminus) (AB171699)

15% SDS-PAGE analysis of ab171699 (3 µg).

Key facts

Purity

>85% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE, Mass Spec

applications

Biologically active

No

Accession

P56962

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 30% Glycerol (glycerin, glycerine), 0.88% Sodium chloride, 0.32% Tris HCl, 0.02% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMGSMSEDEEKVKLRRLEPAIQKFIKIVIPTDLERLRKHQINIEKYQRCRIWDKLHEEHINAGRTVQQLRSNIREIEKLCLKVRKDDLVLLKRMIDPVKEEASAATAEFLQLHLESVEELKKQFNDEETLLQPPLTRSMTVGGAFHTTEAEASSQSLTQIYALPEIPQDQNAAESWETLEADLIELSQLVTDFSLLVNSQQEKIDSIADHVNSAAVNVEEGTKNLGKAAKYKL","proteinLength":"Fragment","predictedMolecularWeight":"28.6 kDa","actualMolecularWeight":null,"aminoAcidEnd":229,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P56962","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

STX17 also known as Syntaxin 17 is a SNARE protein involved in membrane fusion processes. Its molecular weight is approximately 34 kDa. STX17 is predominantly expressed in the endoplasmic reticulum and associated membranes. The protein plays a mechanical role in mediating the fusion of vesicles with target membranes facilitating the transport of molecules within cells. STX17 localizes mostly in cell types associated with high metabolic activity where it supports cellular trafficking demands.
Biological function summary

Syntaxin 17 contributes to the formation of a multiprotein complex involved in the fusion of autophagosomes with lysosomes. This process is important for macroautophagy where damaged organelles and proteins are degraded and recycled. The protein forms a functional unit with other SNARE proteins including VAMP8 and SNAP29 to carry out its role. It ensures cellular homeostasis by facilitating the clearance of unnecessary or damaged cellular components under stress conditions.

Pathways

Syntaxin 17 is critical in the autophagy and endocytosis pathways. These pathways are involved in the degradation and recycling of cellular components maintaining cellular integrity and energy balance. In the autophagy pathway STX17 functions alongside proteins such as LC3 and Beclin-1 coordinating the recognition and processing of autophagosomes. In the endocytosis pathway its interactions help balance the intake and processing of extracellular materials.

STX17 shows significant connections to neurodegenerative disorders and cancer. Its dysfunction in the autophagy process may lead to accumulation of toxic protein aggregates contributing to disorders like Alzheimer's disease. Defects or mutations in the functioning of STX17 have been linked to impaired cellular waste disposal in this context. In cancer alterations in STX17 expression or function can disrupt autophagic processes and affect cancer cell survival. Understanding its link with neurodegenerative proteins such as tau could offer insights for therapeutic strategies.

Specifications

Form

Liquid

Additional notes

ab171699 is purified using conventional chromatography techniques.

General info

Function

SNAREs, soluble N-ethylmaleimide-sensitive factor-attachment protein receptors, are essential proteins for fusion of cellular membranes. SNAREs localized on opposing membranes assemble to form a trans-SNARE complex, an extended, parallel four alpha-helical bundle that drives membrane fusion (PubMed : 23217709, PubMed : 25686604, PubMed : 28306502). STX17 is a SNARE of the autophagosome involved in autophagy through the direct control of autophagosome membrane fusion with the lysosome membrane (PubMed : 23217709, PubMed : 25686604, PubMed : 28306502, PubMed : 28504273). May also play a role in the early secretory pathway where it may maintain the architecture of the endoplasmic reticulum-Golgi intermediate compartment/ERGIC and Golgi and/or regulate transport between the endoplasmic reticulum, the ERGIC and the Golgi (PubMed : 21545355).

Sequence similarities

Belongs to the syntaxin family.

Post-translational modifications

Phosphorylated at Tyr-157 probably by ABL1. Dephosphorylation by PTPN2; regulates exit from the endoplasmic reticulum (By similarity).. (Microbial infection) Cleaved by the L.pneumophila serine protease Lpg1137, impairing endoplasmic reticulum-mitochondria communication, leading to inhibit autophagy.

Product protocols

Target data

SNAREs, soluble N-ethylmaleimide-sensitive factor-attachment protein receptors, are essential proteins for fusion of cellular membranes. SNAREs localized on opposing membranes assemble to form a trans-SNARE complex, an extended, parallel four alpha-helical bundle that drives membrane fusion (PubMed : 23217709, PubMed : 25686604, PubMed : 28306502). STX17 is a SNARE of the autophagosome involved in autophagy through the direct control of autophagosome membrane fusion with the lysosome membrane (PubMed : 23217709, PubMed : 25686604, PubMed : 28306502, PubMed : 28504273). May also play a role in the early secretory pathway where it may maintain the architecture of the endoplasmic reticulum-Golgi intermediate compartment/ERGIC and Golgi and/or regulate transport between the endoplasmic reticulum, the ERGIC and the Golgi (PubMed : 21545355).
See full target information STX17

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com