JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB172844

Recombinant Human SULT2A1/ST2 protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human SULT2A1/ST2 protein is a Human Full Length protein, in the 1 to 285 aa range, expressed in Escherichia coli, with >95%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE, HPLC.

View Alternative Names

HST, STD, SULT2A1, Sulfotransferase 2A1, ST2A1, Bile salt sulfotransferase, Dehydroepiandrosterone sulfotransferase, Hydroxysteroid Sulfotransferase, ST2, SULT2A3, DHEA-ST, DHEA-ST8

Key facts

Purity

>95% SDS-PAGE

Endotoxin level

< 1 EU/µg

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE, HPLC

applications

Biologically active

No

Accession

Q06520

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.58% Sodium chloride, 0.24% Tris

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "HPLC": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

This product was previously labelled as SULT2A1

Sequence info

[{"sequence":"MNHKVHHHHHHMSDDFLWFEGIAFPTMGFRSETLRKVRDEFVIRDEDVIILTYPKSGTNWLAEILCLMHSKGDAKWIQSVPIWERSPWVESEIGYTALSETESPRLFSSHLPIQLFPKSFFSSKAKVIYLMRNPRDVLVSGYFFWKNMKFIKKPKSWEEYFEWFCQGTVLYGSWFDHIHGWMPMREEKNFLLLSYEELKQDTGRTIEKICQFLGKTLEPEELNLILKNSSFQSMKENKMSNYSLLSVDYVVDKAQLLRKGVSGDWKNHFTVAQAEDFDKLFQEKMADLPRELFPWE","proteinLength":"Full Length","predictedMolecularWeight":"35.2 kDa","actualMolecularWeight":null,"aminoAcidEnd":285,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q06520","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

SULT2A1 also known as ST2 is an enzyme belonging to the sulfotransferase family. It mechanically transfers sulfate groups to hydroxy steroids which include substances like dehydroepiandrosterone (DHEA) as well as other sterols. SULT2A1 exhibits an approximate molecular mass of 34 kDa. Expression occurs mainly in the liver and adrenal glands where it plays important role in steroid metabolism. It is also found in the intestine and skin although at lower levels. This enzyme's function in these tissues suggests its involvement in the local regulation of hormone action and metabolism.
Biological function summary

The role of SULT2A1 extends to the regulation of hormones by sulfurylation which makes compounds more soluble and ready for excretion. This process effectively deactivates certain steroid hormones thereby modulating their activity within the body. SULT2A1 does not typically form part of a larger complex but works independently in modifying steroid substrates. The enzyme's activity allows for regulation of hormone availability and subsequently holds substantial influence over multiple physiological processes.

Pathways

SULT2A1 is active in the steroid metabolism and catabolic pathways. It functions alongside other enzymes like CYP3A4 a cytochrome P450 enzyme to transform and clear hormone derivatives from the body. This cooperation is important for maintaining hormonal balance by converting active hormones into less active forms or preparing them for elimination. SULT2A1 contributes specifically to the homeostasis of androgen and estrogen metabolism through the sulfate conjugation pathway regulating the sensitivity of tissues to these hormones.

Alterations in SULT2A1 activity have connections with adrenal diseases and certain forms of cancer. Overactive or deficient SULT2A1 enzyme function can disrupt hormone levels affecting conditions like congenital adrenal hyperplasia. This condition involves hormone imbalances due to enzyme irregularities upstream where SULT2A1's role in sulfate conjugation remains integral. It is also associated with breast cancer where enzyme interactions with estrogen derivatives might modulate proliferative signals; related proteins include estrogen receptor pathways that influence tumor growth. Understanding SULT2A1's function in these contexts aids in grasping the broader impact of hormone regulation and metabolism in disease development.

Specifications

Form

Liquid

Additional notes

Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.

General info

Function

Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfonation of steroids and bile acids in the liver and adrenal glands. Mediates the sulfation of a wide range of steroids and sterols, including pregnenolone, androsterone, DHEA, bile acids, cholesterol and as well many xenobiotics that contain alcohol and phenol functional groups (PubMed : 14573603, PubMed : 18042734, PubMed : 19589875, PubMed : 21187059, PubMed : 2268288, PubMed : 29671343, PubMed : 7678732, PubMed : 7854148). Sulfonation increases the water solubility of most compounds, and therefore their renal excretion, but it can also result in bioactivation to form active metabolites. Plays an important role in maintening steroid and lipid homeostasis (PubMed : 14573603, PubMed : 19589875, PubMed : 21187059). Plays a key role in bile acid metabolism (PubMed : 2268288). In addition, catalyzes the metabolic activation of potent carcinogenic polycyclic arylmethanols (By similarity).

Sequence similarities

Belongs to the sulfotransferase 1 family.

Post-translational modifications

The N-terminus is blocked.

Product protocols

Target data

Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfonation of steroids and bile acids in the liver and adrenal glands. Mediates the sulfation of a wide range of steroids and sterols, including pregnenolone, androsterone, DHEA, bile acids, cholesterol and as well many xenobiotics that contain alcohol and phenol functional groups (PubMed : 14573603, PubMed : 18042734, PubMed : 19589875, PubMed : 21187059, PubMed : 2268288, PubMed : 29671343, PubMed : 7678732, PubMed : 7854148). Sulfonation increases the water solubility of most compounds, and therefore their renal excretion, but it can also result in bioactivation to form active metabolites. Plays an important role in maintening steroid and lipid homeostasis (PubMed : 14573603, PubMed : 19589875, PubMed : 21187059). Plays a key role in bile acid metabolism (PubMed : 2268288). In addition, catalyzes the metabolic activation of potent carcinogenic polycyclic arylmethanols (By similarity).
See full target information SULT2A1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com