JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB140417

Recombinant Human Sumo 1 protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human Sumo 1 protein is a Human Full Length protein, in the 2 to 97 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE, WB.

View Alternative Names

SMT3C, SMT3H3, UBL1, OK/SW-cl.43, SUMO1, Small ubiquitin-related modifier 1, SUMO-1, GAP-modifying protein 1, SMT3 homolog 3, Sentrin, Ubiquitin-homology domain protein PIC1, Ubiquitin-like protein SMT3C, Ubiquitin-like protein UBL1, GMP1, Smt3C

5 Images
Western blot - Recombinant Human Sumo 1 protein (AB140417)
  • WB

Lab

Western blot - Recombinant Human Sumo 1 protein (AB140417)

**Blocking buffer : ** 5% NFDM/TBST This data was developed using ab109005, the same antibody clone in a different buffer formulation.

All lanes:

Western blot - Anti-Sumo 2 + Sumo 3 antibody [EPR4602] (<a href='/en-us/products/primary-antibodies/sumo-2-sumo-3-antibody-epr4602-ab109005'>ab109005</a>) at 1/1000 dilution

Lane 1:

Western blot - Recombinant Human Sumo 1 protein (ab140417) at 0.01 µg

Lane 2:

Western blot - Recombinant Human Sumo 2 protein (<a href='/en-us/products/proteins-peptides/recombinant-human-sumo-2-protein-ab140420'>ab140420</a>) at 0.01 µg

Lane 3:

Recombinant Human Sumo 3 protein (ab140414) at 0.01 µg

Lane 4:

Western blot - Recombinant Human Sumo 4 protein (<a href='/en-us/products/proteins-peptides/recombinant-human-sumo-4-protein-ab157025'>ab157025</a>) at 0.1 µg

Secondary

All lanes:

Western blot - Goat Anti-Rabbit IgG H&L (HRP) (<a href='/en-us/products/secondary-antibodies/goat-rabbit-igg-h-l-hrp-ab97051'>ab97051</a>) at 1/20000 dilution

Predicted band size: 12 kDa

Observed band size: 16 kDa

true

Exposure time: 20s

Western blot - Recombinant Human Sumo 1 protein (AB140417)
  • WB

Lab

Western blot - Recombinant Human Sumo 1 protein (AB140417)

**Blocking buffer : ** 5% NFDM/TBST This data was developed using ab109196, the same antibody clone in a different buffer formulation.

All lanes:

Western blot - Anti-Sumo 2 + Sumo 3 + Sumo 4 antibody [EPR300(2)] (<a href='/en-us/products/primary-antibodies/sumo-2-sumo-3-sumo-4-antibody-epr3002-ab109196'>ab109196</a>) at 1/200 dilution

Lane 1:

Western blot - Recombinant Human Sumo 1 protein (ab140417) at 0.01 µg

Lane 2:

Western blot - Recombinant Human Sumo 2 protein (<a href='/en-us/products/proteins-peptides/recombinant-human-sumo-2-protein-ab140420'>ab140420</a>) at 0.01 µg

Lane 3:

Recombinant Human Sumo 3 protein (ab140414) at 0.01 µg

Lane 4:

Western blot - Recombinant Human Sumo 4 protein (<a href='/en-us/products/proteins-peptides/recombinant-human-sumo-4-protein-ab157025'>ab157025</a>) at 0.1 µg

Secondary

All lanes:

Western blot - Goat Anti-Rabbit IgG H&L (HRP) (<a href='/en-us/products/secondary-antibodies/goat-rabbit-igg-h-l-hrp-ab97051'>ab97051</a>) at 1/20000 dilution

Predicted band size: 12 kDa

Observed band size: 16 kDa

true

Exposure time: 20s

Western blot - Recombinant Human Sumo 1 protein (AB140417)
  • WB

Lab

Western blot - Recombinant Human Sumo 1 protein (AB140417)

**Blocking buffer : ** 5% NFDM/TBST This data was developed using ab133352, the same antibody clone in a different buffer formulation.

All lanes:

Western blot - Anti-Sumo 1 antibody [EP298] (<a href='/en-us/products/primary-antibodies/sumo-1-antibody-ep298-ab133352'>ab133352</a>) at 1/1000 dilution

Lane 1:

Western blot - Recombinant Human Sumo 1 protein (ab140417) at 0.01 µg

Lane 2:

Western blot - Recombinant Human Sumo 2 protein (<a href='/en-us/products/proteins-peptides/recombinant-human-sumo-2-protein-ab140420'>ab140420</a>) at 0.01 µg

Lane 3:

Recombinant Human Sumo 3 protein (ab140414) at 0.01 µg

Lane 4:

Western blot - Recombinant Human Sumo 4 protein (<a href='/en-us/products/proteins-peptides/recombinant-human-sumo-4-protein-ab157025'>ab157025</a>) at 0.1 µg

Secondary

All lanes:

Western blot - Goat Anti-Rabbit IgG H&L (HRP) (<a href='/en-us/products/secondary-antibodies/goat-rabbit-igg-h-l-hrp-ab97051'>ab97051</a>) at 1/20000 dilution

Predicted band size: 11 kDa

Observed band size: 16 kDa

true

Exposure time: 10s

Western blot - Recombinant Human Sumo 1 protein (AB140417)
  • WB

Lab

Western blot - Recombinant Human Sumo 1 protein (AB140417)

**Blocking buffer : ** 5% NFDM/TBST This data was developed using ab126606, the same antibody clone in a different buffer formulation.

All lanes:

Western blot - Anti-Sumo 2 + Sumo 3 + Sumo 4 antibody [EPR7163] (<a href='/en-us/products/primary-antibodies/sumo-2-sumo-3-sumo-4-antibody-epr7163-ab126606'>ab126606</a>) at 1/5000 dilution

Lane 1:

Western blot - Recombinant Human Sumo 1 protein (ab140417) at 0.01 µg

Lane 2:

Western blot - Recombinant Human Sumo 2 protein (<a href='/en-us/products/proteins-peptides/recombinant-human-sumo-2-protein-ab140420'>ab140420</a>) at 0.01 µg

Lane 3:

Recombinant Human Sumo 3 protein (ab140414) at 0.01 µg

Lane 4:

Western blot - Recombinant Human Sumo 4 protein (<a href='/en-us/products/proteins-peptides/recombinant-human-sumo-4-protein-ab157025'>ab157025</a>) at 0.1 µg

Secondary

All lanes:

Western blot - Goat Anti-Rabbit IgG H&L (HRP) (<a href='/en-us/products/secondary-antibodies/goat-rabbit-igg-h-l-hrp-ab97051'>ab97051</a>) at 1/20000 dilution

Predicted band size: 11 kDa

Observed band size: 16 kDa

true

Exposure time: 3s

SDS-PAGE - Recombinant Human Sumo 1 protein (AB140417)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human Sumo 1 protein (AB140417)

SDS-PAGE analysis of ab140417.

Key facts

Purity

>90% Densitometry

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

WB, SDS-PAGE

applications

Biologically active

No

Accession

P63165

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7 Preservative: 1.02% Imidazole Constituents: 25% Glycerol (glycerin, glycerine), 1.75% Sodium chloride, 0.82% Sodium phosphate, 0.004% (R*,R*)-1,4-Dimercaptobutan-2,3-diol, 0.002% PMSF

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"SDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGG","proteinLength":"Full Length","predictedMolecularWeight":"19 kDa","actualMolecularWeight":null,"aminoAcidEnd":97,"aminoAcidStart":2,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P63165","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

SUMO 1 also known as small ubiquitin-like modifier 1 is part of the protein family involved in post-translational modification. The protein mechanically adds a SUMO group to target proteins through sumoylation a process similar to ubiquitination. SUMO 1 typically has a molecular mass of around 11 kDa. It expresses in various tissues and cells including the nucleus and cytoplasm of eukaryotic cells. In addition it is important in processes like nuclear transport transcriptional regulation and protein stabilization.
Biological function summary

SUMO 1 contributes significantly to maintaining cellular homeostasis. It is an integral part of a SUMOylation complex that modifies other proteins to alter their function localization or interactions. Through its modification actions SUMO 1 affects processes such as DNA repair and the cell cycle. By interacting with components of the nuclear pore complex and transcription factors SUMO 1 modulates essential biological activities at multiple levels within the cell.

Pathways

This protein plays a significant role in the PI3K/Akt pathway and Wnt signaling. SUMO 1 associates with proteins like RanGAP1 and various transcription factors highlighting the complexity of its regulatory actions. These associations are important for the regulation of cell survival proliferation and differentiation. SUMOylation by SUMO 1 has been linked to an interference with phosphorylation showing its potential influence on cell signaling pathways.

The dysregulation of SUMO 1 is seen in cancer and neurodegenerative diseases. For instance altered SUMOylation patterns contribute to the progression of certain cancers. Furthermore SUMO 1 interacts with proteins like p53 and these interactions can affect tumor suppression and cell cycle regulation. In neurodegenerative disorders disturbed SUMOylation is associated with protein aggregation and neuronal damage implicating SUMO 1 in diseases like Alzheimer's.

Specifications

Form

Liquid

General info

Function

Ubiquitin-like protein that can be covalently attached to proteins as a monomer or a lysine-linked polymer. Covalent attachment via an isopeptide bond to its substrates requires prior activation by the E1 complex SAE1-SAE2 and linkage to the E2 enzyme UBE2I, and can be promoted by E3 ligases such as PIAS1-4, RANBP2 or CBX4. This post-translational modification on lysine residues of proteins plays a crucial role in a number of cellular processes such as nuclear transport, DNA replication and repair, mitosis and signal transduction. Involved for instance in targeting RANGAP1 to the nuclear pore complex protein RANBP2. Covalently attached to the voltage-gated potassium channel KCNB1; this modulates the gating characteristics of KCNB1 (PubMed : 19223394). Polymeric SUMO1 chains are also susceptible to polyubiquitination which functions as a signal for proteasomal degradation of modified proteins. May also regulate a network of genes involved in palate development. Covalently attached to ZFHX3 (PubMed : 24651376).

Sequence similarities

Belongs to the ubiquitin family. SUMO subfamily.

Post-translational modifications

Cleavage of precursor form by SENP1 or SENP2 is necessary for function.. Polymeric SUMO1 chains undergo polyubiquitination by RNF4.

Subcellular localisation

Nucleus membrane

Product protocols

Target data

Ubiquitin-like protein that can be covalently attached to proteins as a monomer or a lysine-linked polymer. Covalent attachment via an isopeptide bond to its substrates requires prior activation by the E1 complex SAE1-SAE2 and linkage to the E2 enzyme UBE2I, and can be promoted by E3 ligases such as PIAS1-4, RANBP2 or CBX4. This post-translational modification on lysine residues of proteins plays a crucial role in a number of cellular processes such as nuclear transport, DNA replication and repair, mitosis and signal transduction. Involved for instance in targeting RANGAP1 to the nuclear pore complex protein RANBP2. Covalently attached to the voltage-gated potassium channel KCNB1; this modulates the gating characteristics of KCNB1 (PubMed : 19223394). Polymeric SUMO1 chains are also susceptible to polyubiquitination which functions as a signal for proteasomal degradation of modified proteins. May also regulate a network of genes involved in palate development. Covalently attached to ZFHX3 (PubMed : 24651376).
See full target information SUMO1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com