JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB181961

Recombinant Human Surfactant protein D/SP-D (denatured) (His tag N-Terminus)

Be the first to review this product! Submit a review

|

(1 Publication)

Recombinant Human Surfactant protein D/SP-D (denatured) (His tag N-Terminus) is a Human Fragment protein, in the 224 to 375 aa range, expressed in Escherichia coli, with >85%, suitable for SDS-PAGE.

View Alternative Names

COLEC7, PSPD, SFTP4, SFTPD, Pulmonary surfactant-associated protein D, PSP-D, SP-D, Collectin-7, Lung surfactant protein D

1 Images
SDS-PAGE - Recombinant Human Surfactant protein D/SP-D (denatured) (His tag N-Terminus) (AB181961)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human Surfactant protein D/SP-D (denatured) (His tag N-Terminus) (AB181961)

3µg by SDS-PAGE under reducing condition and visualized by coomassie blue stain.

Key facts

Purity

>85% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

P35247

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 10% Glycerol (glycerin, glycerine), 2.4% Urea, 0.32% Tris HCl

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

Previously labelled as Surfactant protein D.

Sequence info

[{"sequence":"VASLRQQVEALQGQVQHLQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLLCTQAGGQLASPRSAAENAALQQLVVAKNEAAFLSMTDSKTEGKFTYPTGESLVYSNWAPGEPNDDGGSEDCVEIFTNGKWNDRACGEKRLVVCEF","proteinLength":"Fragment","predictedMolecularWeight":"18.9 kDa","actualMolecularWeight":null,"aminoAcidEnd":375,"aminoAcidStart":224,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P35247","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Surfactant protein D (SP-D) also known as protein D functions as an important component of the innate immune system. It weighs around 43 kDa and is primarily expressed in pulmonary alveoli where lung cells synthesize it. SP-D belongs to the collectin family and has a C-type lectin domain that allows binding to carbohydrate structures on microbial surfaces. This ability enables SP-D to interact directly with various pathogens and infected cells targeting them for clearance. Researchers often study SP-D with 'anti-surfactant' antibodies using methods like the ELISA protocol including versions like ELISA Sp and ELISA Denise.
Biological function summary

SP-D contributes to host defense by enhancing the uptake and elimination of pathogens by immune cells such as macrophages. Part of a larger protein complex SP-D can opsonize bacteria and viruses facilitating phagocytosis. Its role extends to modulating inflammation by affecting the production of pro-inflammatory cytokines. By maintaining homeostasis in surfactant composition it indirectly supports lung function and protects against lung injury. SP-D’s function involves communication and transmission of signals within the immune system making it integral to pulmonary immune processes.

Pathways

Surfactant protein D is involved in the regulation of the complement and coagulation cascades as well as the pathogen recognition pathway. It is closely related to other collectins such as surfactant protein A (SP-A) which share similar mechanisms in the immune response. SP-D's interaction within these pathways highlights its role in identifying and neutralizing pathogens. Through its connections with related proteins SP-D plays an important part in modulating immune responses ensuring effective pathogen elimination without excessive inflammation.

SP-D has been linked with respiratory diseases such as chronic obstructive pulmonary disease (COPD) and pulmonary fibrosis. These conditions may involve impaired SP-D function or expression levels potentially due to genetic factors or environmental influences. SP-D also interacts with proteins like SP-A in these diseases participating in lung immune responses. Disrupted regulation of SP-D can contribute to chronic inflammatory states in the lungs exacerbating disease progression and leading to compromised lung function. Understanding SP-D's role in these contexts offers potential therapeutic insights for targeting pathological inflammation.

Specifications

Form

Liquid

General info

Function

Contributes to the lung's defense against inhaled microorganisms, organic antigens and toxins. Interacts with compounds such as bacterial lipopolysaccharides, oligosaccharides and fatty acids and modulates leukocyte action in immune response. May participate in the extracellular reorganization or turnover of pulmonary surfactant. Binds strongly maltose residues and to a lesser extent other alpha-glucosyl moieties.

Sequence similarities

Belongs to the SFTPD family.

Post-translational modifications

The N-terminus is blocked.. Hydroxylation on proline residues within the sequence motif, GXPG, is most likely to be 4-hydroxy as this fits the requirement for 4-hydroxylation in vertebrates.. S-nitrosylation at Cys-35 and Cys-40 alters the quaternary structure which results in a pro-inflammatory chemoattractive signaling activity with macrophages.

Product protocols

Target data

Contributes to the lung's defense against inhaled microorganisms, organic antigens and toxins. Interacts with compounds such as bacterial lipopolysaccharides, oligosaccharides and fatty acids and modulates leukocyte action in immune response. May participate in the extracellular reorganization or turnover of pulmonary surfactant. Binds strongly maltose residues and to a lesser extent other alpha-glucosyl moieties.
See full target information SFTPD

Publications (1)

Recent publications for all applications. Explore the full list and refine your search

The Journal of biological chemistry 293:4901-4912 PubMed29414772

2018

Fungal melanin stimulates surfactant protein D-mediated opsonization of and host immune response to spores.

Applications

Unspecified application

Species

Unspecified reactive species

Sarah Sze Wah Wong,Manjusha Rani,Eswari Dodagatta-Marri,Oumaima Ibrahim-Granet,Uday Kishore,Jagadeesh Bayry,Jean-Paul Latgé,Arvind Sahu,Taruna Madan,Vishukumar Aimanianda
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com