JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB86442

Recombinant Human Syntaxin 1a protein (Tag Free)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human Syntaxin 1a protein (Tag Free) is a Human Fragment protein, in the 1 to 226 aa range, expressed in Escherichia coli, with >95%, suitable for SDS-PAGE.

View Alternative Names

STX1, STX1A, Syntaxin-1A, Neuron-specific antigen HPC-1

1 Images
SDS-PAGE - Recombinant Human Syntaxin 1a protein (Tag Free) (AB86442)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human Syntaxin 1a protein (Tag Free) (AB86442)

15% SDS-PAGE showing ab86442 at approximately 26.1kDa.

Key facts

Purity

>95% SDS-PAGE

Expression system

Escherichia coli

Tags

Tag free

Applications

SDS-PAGE

applications

Biologically active

No

Accession

Q16623

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.5 Constituents: 10% Glycerol (glycerin, glycerine), 0.242% Tris, 0.0154% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MKDRTQELRTAKDSDDDDDVAVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQ","proteinLength":"Fragment","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":226,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q16623","tags":[]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Syntaxin 1a also known as STX1A is an essential protein in cellular mechanisms involved in neurotransmitter release. This protein weighing approximately 33 kDa plays a direct role in synaptic vesicle fusion through its function as a member of the SNARE (Soluble N-ethylmaleimide-sensitive factor Attachment protein Receptor) complex. Syntaxin 1a is highly expressed in the brain especially in areas like the hippocampus and cerebral cortex where it facilitates rapid neurotransmission important for communication between neurons.
Biological function summary

The involvement of Syntaxin 1a in synaptic transmission is significant. It forms a complex with other proteins such as SNAP-25 and VAMP enabling the docking and fusion of synaptic vesicles with the presynaptic membrane. This action results in the release of neurotransmitters into the synaptic cleft which then bind to receptors on the postsynaptic neuron to propagate neural signals. Syntaxin 1a ensures efficient synaptic activity and is indispensable for maintaining synaptic plasticity which is critical for learning and memory.

Pathways

Syntaxin 1a is pivotal in the regulation of neurotransmitter release within the synaptic vesicle cycle pathway. This pathway includes the assembly and disassembly of the SNARE complex which are processes vital for neurotransmitter exocytosis. Syntaxin 1a engages closely with proteins like synaptotagmin acting as calcium sensors and Munc18 which helps in initiating SNARE assembly. These interactions highlight the careful orchestration of vesicle trafficking and fusion events necessary for effective synaptic communication.

Dysfunctions in Syntaxin 1a are linked to neurological conditions such as epilepsy and autism spectrum disorders. Alterations or mutations in Syntaxin 1a can lead to improper synaptic vesicle fusion and disrupted neurotransmitter release which are characteristics of these disorders. Additionally Syntaxin 1a interacts with proteins like Munc18-1 whose mutations are associated with similar synaptic transmission deficiencies further implicating the involvement of Syntaxin 1a in these pathologies.

Specifications

Form

Liquid

Additional notes

ab86442 is purified using conventional chromatography techniques.

General info

Function

Plays an essential role in hormone and neurotransmitter calcium-dependent exocytosis and endocytosis (PubMed : 26635000). Part of the SNARE (Soluble NSF Attachment Receptor) complex composed of SNAP25, STX1A and VAMP2 which mediates the fusion of synaptic vesicles with the presynaptic plasma membrane. STX1A and SNAP25 are localized on the plasma membrane while VAMP2 resides in synaptic vesicles. The pairing of the three SNAREs from the N-terminal SNARE motifs to the C-terminal anchors leads to the formation of the SNARE complex, which brings membranes into close proximity and results in final fusion. Participates in the calcium-dependent regulation of acrosomal exocytosis in sperm (PubMed : 23091057). Also plays an important role in the exocytosis of hormones such as insulin or glucagon-like peptide 1 (GLP-1) (By similarity).

Sequence similarities

Belongs to the syntaxin family.

Post-translational modifications

Phosphorylated by CK2 (By similarity). Phosphorylation at Ser-188 by DAPK1 significantly decreases its interaction with STXBP1.. Sumoylated, sumoylation is required for regulation of synaptic vesicle endocytosis.

Product protocols

Target data

Plays an essential role in hormone and neurotransmitter calcium-dependent exocytosis and endocytosis (PubMed : 26635000). Part of the SNARE (Soluble NSF Attachment Receptor) complex composed of SNAP25, STX1A and VAMP2 which mediates the fusion of synaptic vesicles with the presynaptic plasma membrane. STX1A and SNAP25 are localized on the plasma membrane while VAMP2 resides in synaptic vesicles. The pairing of the three SNAREs from the N-terminal SNARE motifs to the C-terminal anchors leads to the formation of the SNARE complex, which brings membranes into close proximity and results in final fusion. Participates in the calcium-dependent regulation of acrosomal exocytosis in sperm (PubMed : 23091057). Also plays an important role in the exocytosis of hormones such as insulin or glucagon-like peptide 1 (GLP-1) (By similarity).
See full target information STX1A

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com