JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB101950

Recombinant Human Syntenin protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human Syntenin protein is a Human Full Length protein, in the 1 to 298 aa range, expressed in Escherichia coli, with >90%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

MDA9, SYCL, SDCBP, Syntenin-1, Melanoma differentiation-associated protein 9, Pro-TGF-alpha cytoplasmic domain-interacting protein 18, Scaffold protein Pbp1, Syndecan-binding protein 1, MDA-9, TACIP18

1 Images
SDS-PAGE - Recombinant Human Syntenin protein (AB101950)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human Syntenin protein (AB101950)

15% SDS-PAGE analysis of 3μg ab101950.

Key facts

Purity

>90% SDS-PAGE

Endotoxin level

< 1 EU/µg

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

Mass Spec, SDS-PAGE

applications

Biologically active

No

Accession

O00560

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 40% Glycerol (glycerin, glycerine), 0.58% Sodium chloride, 0.316% Tris HCl

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMSLYPSLEDLKVDKVIQAQTAFSANPANPAILSEASAPIPHDGNLYPRLYPELSQYMGLSLNEEEIRANVAVVSGAPLQGQLVARPSSINYMVAPVTGNDVGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITMTIRDRPFERTITMHKDSTGHVGFIFKNGKITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPAFIFEHIIKRMAPSIMKSLMDHTIPEV","proteinLength":"Full Length","predictedMolecularWeight":"34.6 kDa","actualMolecularWeight":null,"aminoAcidEnd":298,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"O00560","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Syntenin also known as syndecan binding protein (SDCBP) is a multifunctional adaptor protein with a molecular weight of approximately 32 kDa. It typically finds expression in various tissues with high levels noted in the brain placenta and kidney. Mechanically syntenin facilitates cellular signal transduction by interacting with the cytoplasmic domains of syndecans therefore playing a vital role in modulating those signals. Notably syntenin associates with the actin cytoskeleton impacting cell shape and motility.
Biological function summary

Syntenin regulates important cellular processes such as cell adhesion migration and intracellular trafficking. It often associates with protein complexes like those formed with PDZ domain-containing proteins enhancing its ability to link and organize diverse cellular pathways. By influencing these cellular processes syntenin has an impact on tissue development and repair mechanisms. This protein's interaction with the cytoskeleton and membrane-bound molecules allows it to act as an essential mediator in cellular communication.

Pathways

Syntenin is integral to the Wnt and TGF-beta signaling pathways which regulate cell growth and differentiation. Syntenin interacts with proteins such as β-catenin and Smad3 within these pathways linking extracellular signaling cues to specific intracellular responses. These interactions highlight syntenin's role in modulating gene expression and maintaining cellular homeostasis especially in processes like embryogenesis and tissue regeneration.

Syntenin holds significance in cancer progression and neurodegenerative diseases. Its overexpression or altered function correlates with increased metastasis in various cancers associated with proteins like syndecan-1 and matrix metalloproteinases. In neurodegeneration dysregulated syntenin expression influences signaling pathways potentially contributing to disorders like Alzheimer's disease. Understanding syntenin's role in these conditions might lead to more targeted therapeutic strategies and improved disease management.

Specifications

Form

Liquid

Additional notes

ab101950 is purified using conventional chromatography techniques.

General info

Function

Multifunctional adapter protein involved in diverse array of functions including trafficking of transmembrane proteins, neuro and immunomodulation, exosome biogenesis, and tumorigenesis (PubMed : 26291527). Positively regulates TGFB1-mediated SMAD2/3 activation and TGFB1-induced epithelial-to-mesenchymal transition (EMT) and cell migration in various cell types. May increase TGFB1 signaling by enhancing cell-surface expression of TGFR1 by preventing the interaction between TGFR1 and CAV1 and subsequent CAV1-dependent internalization and degradation of TGFR1 (PubMed : 25893292). In concert with SDC1/4 and PDCD6IP, regulates exosome biogenesis (PubMed : 22660413). Regulates migration, growth, proliferation, and cell cycle progression in a variety of cancer types (PubMed : 26539120). In adherens junctions may function to couple syndecans to cytoskeletal proteins or signaling components. Seems to couple transcription factor SOX4 to the IL-5 receptor (IL5RA) (PubMed : 11498591). May also play a role in vesicular trafficking (PubMed : 11179419). Seems to be required for the targeting of TGFA to the cell surface in the early secretory pathway (PubMed : 10230395).

Post-translational modifications

Phosphorylated on tyrosine residues.

Subcellular localisation

Nucleus

Product protocols

Target data

Multifunctional adapter protein involved in diverse array of functions including trafficking of transmembrane proteins, neuro and immunomodulation, exosome biogenesis, and tumorigenesis (PubMed : 26291527). Positively regulates TGFB1-mediated SMAD2/3 activation and TGFB1-induced epithelial-to-mesenchymal transition (EMT) and cell migration in various cell types. May increase TGFB1 signaling by enhancing cell-surface expression of TGFR1 by preventing the interaction between TGFR1 and CAV1 and subsequent CAV1-dependent internalization and degradation of TGFR1 (PubMed : 25893292). In concert with SDC1/4 and PDCD6IP, regulates exosome biogenesis (PubMed : 22660413). Regulates migration, growth, proliferation, and cell cycle progression in a variety of cancer types (PubMed : 26539120). In adherens junctions may function to couple syndecans to cytoskeletal proteins or signaling components. Seems to couple transcription factor SOX4 to the IL-5 receptor (IL5RA) (PubMed : 11498591). May also play a role in vesicular trafficking (PubMed : 11179419). Seems to be required for the targeting of TGFA to the cell surface in the early secretory pathway (PubMed : 10230395).
See full target information SDCBP

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com