JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB271751

Recombinant Human TAC1 protein (Fc tag C-Terminus + Avi tag C-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human TAC1 protein (Fc tag C-Terminus + Avi tag C-Terminus) is a Human Fragment protein, in the 23 to 166 aa range, expressed in HEK 293 cells, with >90%, suitable for SDS-PAGE.

View Alternative Names

NKA, NKNA, TAC2, TAC1, Protachykinin-1, PPT

1 Images
SDS-PAGE - Recombinant Human TAC1 protein (Fc tag C-Terminus + Avi tag C-Terminus) (AB271751)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human TAC1 protein (Fc tag C-Terminus + Avi tag C-Terminus) (AB271751)

SDS-PAGE analysis of 4 μg ab271751.

Key facts

Purity

>90% SDS-PAGE

Expression system

HEK 293 cells

Tags

Fc tag C-Terminus Avi tag C-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

P20366

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.4 Constituents: 20% Glycerol (glycerin, glycerine), 0.64% Sodium chloride, 0.13% Sodium phosphate, 0.02% Potassium chloride

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"QGLWTGVAMRSCPEEQYWDPLLGTCMSCKTICNHQSQRTCAAFCRSLSCRKEQGKFYDHLLRDCISCASICGQHPKQCAYFCENKLRSPVNLPPELRRQRSGEVENNSDNSGRYQGLEHRGSEASPALPGLKLSADQVALVYST","proteinLength":"Fragment","predictedMolecularWeight":"45 kDa","actualMolecularWeight":null,"aminoAcidEnd":166,"aminoAcidStart":23,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"P20366","tags":[{"tag":"Fc","terminus":"C-Terminus"},{"tag":"Avi","terminus":"C-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

TAC1 also known as Tachykinin Precursor 1 or Substance P is a gene that encodes a peptide which functions mechanically in neuropeptide signaling. TAC1 polypeptide has a mass of approximately 15 kDa. It is highly expressed in cells of the nervous system including the central and peripheral systems. The peptide derived from TAC1 participates in neurotransmission and modulates inflammatory responses.
Biological function summary

TAC1 influences multiple processes primarily through interaction with the neurokinin receptors. The peptide is not part of a larger protein complex but it exerts its effects by binding to the tachykinin receptor NK1 which plays a role in regulating pain responses mood anxiety and the emetic reflex. TAC1-derived peptides are involved in promoting vasodilation and bronchoconstriction impacting cardiovascular and respiratory systems.

Pathways

TAC1 acts in the tachykinin signaling pathway and affects various physiological processes. It is critical for the neurokinin pathway impacting the transmission of stress signals. TAC1 interacts closely with proteins like neurokinin-1 receptor (NK1R) and is involved in downstream effects such as calcium signaling pathways. These pathways highlight TAC1's role in communicating pain and stress stimuli across neurons.

TAC1 relates strongly to chronic pain and inflammatory diseases. Abnormal TAC1 expression has been linked to fibromyalgia and inflammatory bowel disease. In these conditions TAC1 peptides engage neuroinflammatory pathways often in association with other neuropeptides like CGRP (calcitonin gene-related peptide) leading to elevated inflammatory states. Understanding TAC1 interactions helps in strategizing therapeutic approaches for these conditions.

Specifications

Form

Liquid

General info

Function

Tachykinins are active peptides which excite neurons, evoke behavioral responses, are potent vasodilators and secretagogues, and contract (directly or indirectly) many smooth muscles.. Substance P. Is a ligand for TACR1, and triggers G protein-coupled receptor signaling via activation of phosphatidylinositol hydrolysis by phospholipase C. Substance P binding to TACR1 also triggers signaling via activation of adenylate cyclase activity which results in increased intracellular levels of cyclic AMP (cAMP) (By similarity). Is also a TACR3 agonist with low receptor affinity (PubMed : 37391393). Basic secretagogue neuropeptide released from the terminals of specific sensory nerves (PubMed : 30686732). Acts as a ligand for MRGPRX2 receptor in mast cells, initiating a signaling that mediates neurogenic inflammation and pain (PubMed : 30686732, PubMed : 34789875). Neurogenic inflammation includes mast cell activation, recruitment of immune cells and release of inflammatory mediators, such as cytokines and chemokines (By similarity). The inflammatory response can then activate or sensitize nociceptors, promoting pain (By similarity).. Neurokinin A. Is a ligand for TACR2, and triggers G protein-coupled receptor signaling via activation of G(q) and phosphatidylinositol hydrolysis by phospholipase C (PubMed : 35882833). Binding to TACR2 also triggers signaling via activation of adenylate cyclase activity which results in increased intracellular levels of cyclic AMP (cAMP).

Sequence similarities

Belongs to the tachykinin family.

Post-translational modifications

Substance P. The substance P form is cleaved at Pro-59 by the prolyl endopeptidase FAP (seprase) activity (in vitro) (PubMed:21314817). Substance P is also cleaved and degraded by Angiotensin-converting enzyme (ACE) and neprilysin (MME) (PubMed:6208535).

Product protocols

Target data

Tachykinins are active peptides which excite neurons, evoke behavioral responses, are potent vasodilators and secretagogues, and contract (directly or indirectly) many smooth muscles.. Substance P. Is a ligand for TACR1, and triggers G protein-coupled receptor signaling via activation of phosphatidylinositol hydrolysis by phospholipase C. Substance P binding to TACR1 also triggers signaling via activation of adenylate cyclase activity which results in increased intracellular levels of cyclic AMP (cAMP) (By similarity). Is also a TACR3 agonist with low receptor affinity (PubMed : 37391393). Basic secretagogue neuropeptide released from the terminals of specific sensory nerves (PubMed : 30686732). Acts as a ligand for MRGPRX2 receptor in mast cells, initiating a signaling that mediates neurogenic inflammation and pain (PubMed : 30686732, PubMed : 34789875). Neurogenic inflammation includes mast cell activation, recruitment of immune cells and release of inflammatory mediators, such as cytokines and chemokines (By similarity). The inflammatory response can then activate or sensitize nociceptors, promoting pain (By similarity).. Neurokinin A. Is a ligand for TACR2, and triggers G protein-coupled receptor signaling via activation of G(q) and phosphatidylinositol hydrolysis by phospholipase C (PubMed : 35882833). Binding to TACR2 also triggers signaling via activation of adenylate cyclase activity which results in increased intracellular levels of cyclic AMP (cAMP).
See full target information TAC1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com