JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB198119

Recombinant Human TAF1 protein (Tagged)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human TAF1 protein (Tagged) is a Human Fragment protein, in the 1519 to 1651 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE.

View Alternative Names

BA2R, CCG1, CCGS, TAF2A, TAF1, Transcription initiation factor TFIID subunit 1, Cell cycle gene 1 protein, TBP-associated factor 250 kDa, Transcription initiation factor TFIID 250 kDa subunit, p250, TAF(II)250, TAFII-250, TAFII250

1 Images
SDS-PAGE - Recombinant Human TAF1 protein (Tagged) (AB198119)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human TAF1 protein (Tagged) (AB198119)

4-20% SDS-PAGE stained with Coomassie Blue.
Lane 1 : ab198119 (2.7 μg)
Lane 2 : Protein Marker

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

GST tag N-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

P21675

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 20% Glycerol (glycerin, glycerine), 0.64% Sodium chloride, 0.63% Tris HCl, 0.02% Potassium chloride

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSLLDDDDQVAFSFILDNIVTQKMMAVPDSWPFHHPVNKKFVPDYYKVIVNPMDLETIRKNISKHKYQSRESFLDDVNLILANSVKYNGPESQYTKTAQEIVNVCYQTLTEYDEHLTQLEKDICTAKEAALEEAE","proteinLength":"Fragment","predictedMolecularWeight":"42.2 kDa","actualMolecularWeight":null,"aminoAcidEnd":1651,"aminoAcidStart":1519,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P21675","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

TAF1 also known as TATA-box binding protein associated factor 1 has a mechanical role as a transcription factor in the initiation process of transcription. This protein forms a part of the larger transcription factor IID (TFIID) complex weighing approximately 200 kDa. TAF1 expresses broadly in tissues where it plays an important role in mediating transcriptional regulation. It is a general transcription factor that serves as a molecular scaffold essential for recruiting the necessary machinery to specific promotor regions of DNA for transcription activation.
Biological function summary

TAF1 interacts extensively with other TFIID components to control the formation of the pre-initiation complex on core promoters. This protein is integral to the regulation of gene expression by modulating transcriptional activity in cells. TAF1 acts as a histone acetyltransferase and a kinase modifying other proteins' functions and structural capabilities in the transcription process. Its enzymatic activities make it essential for the phosphorylation and acetylation of histones directly impacting the accessibility of chromatin for transcription.

Pathways

TAF1 functions prominently in the RNA polymerase II transcription initiation pathway. Its interactions with TATA-binding protein and other TAFs facilitate the robust expression of genes essential for various cellular functions. TAF1 establishes connections with proteins like TBP acting within the canonical pathway that guides precise transcription initiation. Additionally TAF1 partakes in the p53 signaling pathway where it interacts with several p53 regulators influencing cell cycle regulation and apoptosis.

TAF1 mutations are linked to X-linked dystonia-parkinsonism and certain neurodegenerative disorders. Aberrations in TAF1 function impact transcriptional regulation leading to dysregulation in neuronal gene expression. Furthermore TAF1 associations with Huntington's disease have been documented highlighting its role in neuronal survival and stress response. In these diseases altered pathways implicate TAF1 with other proteins such as Huntingtin underlining its importance in maintaining neuronal health and function.

Specifications

Form

Liquid

General info

Function

The TFIID basal transcription factor complex plays a major role in the initiation of RNA polymerase II (Pol II)-dependent transcription (PubMed : 33795473). TFIID recognizes and binds promoters with or without a TATA box via its subunit TBP, a TATA-box-binding protein, and promotes assembly of the pre-initiation complex (PIC) (PubMed : 33795473). The TFIID complex consists of TBP and TBP-associated factors (TAFs), including TAF1, TAF2, TAF3, TAF4, TAF5, TAF6, TAF7, TAF8, TAF9, TAF10, TAF11, TAF12 and TAF13 (PubMed : 33795473). TAF1 is the largest component and core scaffold of the TFIID complex, involved in nucleating complex assembly (PubMed : 25412659, PubMed : 27007846, PubMed : 33795473). TAF1 forms a promoter DNA binding subcomplex of TFIID, together with TAF7 and TAF2 (PubMed : 33795473). Contains novel N- and C-terminal Ser/Thr kinase domains which can autophosphorylate or transphosphorylate other transcription factors (PubMed : 25412659, PubMed : 8625415). Phosphorylates TP53 on 'Thr-55' which leads to MDM2-mediated degradation of TP53 (PubMed : 25412659). Phosphorylates GTF2A1 and GTF2F1 on Ser residues (PubMed : 25412659). Possesses DNA-binding activity (PubMed : 25412659). Essential for progression of the G1 phase of the cell cycle (PubMed : 11278496, PubMed : 15053879, PubMed : 2038334, PubMed : 8450888, PubMed : 8625415, PubMed : 9660973, PubMed : 9858607). Exhibits histone acetyltransferase activity towards histones H3 and H4 (PubMed : 15870300).

Sequence similarities

Belongs to the TAF1 family.

Post-translational modifications

Phosphorylated by casein kinase II in vitro.

Subcellular localisation

Nucleus

Product protocols

For this product, it's our understanding that no specific protocols are required. You can visit:

Target data

The TFIID basal transcription factor complex plays a major role in the initiation of RNA polymerase II (Pol II)-dependent transcription (PubMed : 33795473). TFIID recognizes and binds promoters with or without a TATA box via its subunit TBP, a TATA-box-binding protein, and promotes assembly of the pre-initiation complex (PIC) (PubMed : 33795473). The TFIID complex consists of TBP and TBP-associated factors (TAFs), including TAF1, TAF2, TAF3, TAF4, TAF5, TAF6, TAF7, TAF8, TAF9, TAF10, TAF11, TAF12 and TAF13 (PubMed : 33795473). TAF1 is the largest component and core scaffold of the TFIID complex, involved in nucleating complex assembly (PubMed : 25412659, PubMed : 27007846, PubMed : 33795473). TAF1 forms a promoter DNA binding subcomplex of TFIID, together with TAF7 and TAF2 (PubMed : 33795473). Contains novel N- and C-terminal Ser/Thr kinase domains which can autophosphorylate or transphosphorylate other transcription factors (PubMed : 25412659, PubMed : 8625415). Phosphorylates TP53 on 'Thr-55' which leads to MDM2-mediated degradation of TP53 (PubMed : 25412659). Phosphorylates GTF2A1 and GTF2F1 on Ser residues (PubMed : 25412659). Possesses DNA-binding activity (PubMed : 25412659). Essential for progression of the G1 phase of the cell cycle (PubMed : 11278496, PubMed : 15053879, PubMed : 2038334, PubMed : 8450888, PubMed : 8625415, PubMed : 9660973, PubMed : 9858607). Exhibits histone acetyltransferase activity towards histones H3 and H4 (PubMed : 15870300).
See full target information TAF1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Associated Products

Select an associated product type
Alternative Product
Proteins & Peptides

AB198139

Recombinant human TAF1 protein

proteins-peptides

recombinant-human-taf1-protein-ab198139

0

(0 reviews)

Alternative Product
Proteins & Peptides

AB198086

Recombinant Human TAF1 protein

proteins-peptides

recombinant-human-taf1-protein-ab198086

0

(0 reviews)

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com