JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB271496

Recombinant Human TCEB2/Elongin-B protein (Tagged)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human TCEB2/Elongin-B protein (Tagged) is a Human Full Length protein, in the 2 to 118 aa range, expressed in HEK 293 cells, with >90%, suitable for SDS-PAGE.

View Alternative Names

TCEB2, ELOB, Elongin-B, EloB, Elongin 18 kDa subunit, RNA polymerase II transcription factor SIII subunit B, SIII p18, Transcription elongation factor B polypeptide 2

1 Images
SDS-PAGE - Recombinant Human TCEB2/Elongin-B protein (Tagged) (AB271496)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human TCEB2/Elongin-B protein (Tagged) (AB271496)

SDS-PAGE analysis of ab271496.

Key facts

Purity

>90% SDS-PAGE

Expression system

HEK 293 cells

Tags

DDDDK tag N-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

Q15370

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 20% Glycerol (glycerin, glycerine), 0.64% Sodium chloride, 0.63% Tris HCl, 0.05% (R*,R*)-1,4-Dimercaptobutan-2,3-diol, 0.02% Potassium chloride

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"DVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQAVQ","proteinLength":"Full Length","predictedMolecularWeight":"14 kDa","actualMolecularWeight":null,"aminoAcidEnd":118,"aminoAcidStart":2,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"Q15370","tags":[{"tag":"DDDDK","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

TCEB2 also known as Elongin-B is a protein that is part of the Elongin complex. It has an approximate molecular mass of 14 kDa. Elongin-B is widely expressed in various tissues including the heart liver and kidney. This protein works mechanically by increasing the transcription elongation efficiency of RNA polymerase II which is key for proper gene expression. Elongin-B functions within a cellular environment where it modulates transcriptional processes.
Biological function summary

Elongin-B participates as a component of the Elongin complex which also includes Elongin-C and Elongin-A. This complex enhances the rate of transcriptional elongation by alleviating the effects of transcriptional pausing or stalling. By facilitating the transcription of DNA to mRNA Elongin-B indirectly influences various cellular functions and growth processes. It acts by stabilizing other subunits of the complex contributing to the overall efficiency of gene expression systems.

Pathways

Elongin-B takes part in the ubiquitin-proteasome pathway a critical cellular system for protein degradation and turnover. It partners with others like Von Hippel-Lindau (VHL) protein within this pathway. Apart from protein degradation Elongin-B is also involved in the regulation of hypoxia-inducible factor (HIF) connecting it to pathways related to cellular response to oxygen levels. This interaction illustrates the protein's role in managing levels of various proteins related to stress responses in cells.

Elongin-B has implications in cancer and von Hippel-Lindau disease. Abnormal functioning or expression influences cellular mechanisms like uncontrolled cell growth seen in cancer proliferation. Elongin-B's interaction with VHL protein affects von Hippel-Lindau syndrome a condition that leads to tumor and cyst development in different parts of the body. The study of Elongin-B's role in these pathologies helps in understanding disease progression and identifying potential therapeutic targets.

Specifications

Form

Liquid

General info

Function

SIII, also known as elongin, is a general transcription elongation factor that increases the RNA polymerase II transcription elongation past template-encoded arresting sites. Subunit A is transcriptionally active and its transcription activity is strongly enhanced by binding to the dimeric complex of the SIII regulatory subunits B and C (elongin BC complex) (PubMed : 7638163). In embryonic stem cells, the elongin BC complex is recruited by EPOP to Polycomb group (PcG) target genes in order generate genomic region that display both active and repressive chromatin properties, an important feature of pluripotent stem cells (By similarity).. Core component of multiple cullin-2 and cullin-5-RING E3 ubiquitin-protein ligase complexes (ECS complexes), which mediate the ubiquitination of target proteins (PubMed : 10205047, PubMed : 12004076, PubMed : 12050673, PubMed : 15590694, PubMed : 26138980, PubMed : 29775578, PubMed : 29779948, PubMed : 33268465, PubMed : 38326650). By binding to BC-box motifs it seems to link target recruitment subunits, like VHL and members of the SOCS box family, to Cullin/RBX1 modules that activate E2 ubiquitination enzymes (PubMed : 10205047, PubMed : 12004076, PubMed : 12050673, PubMed : 15590694). Component the von Hippel-Lindau ubiquitination complex CBC(VHL) (PubMed : 10205047, PubMed : 12004076, PubMed : 12050673, PubMed : 15590694). A number of ECS complexes (containing either KLHDC2, KLHDC3, KLHDC10, APPBP2, FEM1A, FEM1B or FEM1C as substrate-recognition component) are part of the DesCEND (destruction via C-end degrons) pathway, which recognizes a C-degron located at the extreme C terminus of target proteins, leading to their ubiquitination and degradation (PubMed : 26138980, PubMed : 29775578, PubMed : 29779948). The ECS(ASB9) complex mediates ubiquitination and degradation of CKB (PubMed : 33268465). As part of a multisubunit ubiquitin ligase complex, polyubiquitinates monoubiquitinated POLR2A (PubMed : 19920177). ECS(LRR1) ubiquitinates MCM7 and promotes CMG replisome disassembly by VCP and chromatin extraction during S-phase (By similarity).. (Microbial infection) Following infection by HIV-1 virus, component of a cullin-5-RING E3 ubiquitin-protein ligase complex (ECS complex) hijacked by the HIV-1 Vif protein, which catalyzes ubiquitination and degradation of APOBEC3F and APOBEC3G (PubMed : 18562529, PubMed : 20532212, PubMed : 22190037, PubMed : 24225024, PubMed : 24402281, PubMed : 36754086). The complex can also ubiquitinate APOBEC3H to some extent (PubMed : 37640699).

Subcellular localisation

Nucleus

Product protocols

Target data

SIII, also known as elongin, is a general transcription elongation factor that increases the RNA polymerase II transcription elongation past template-encoded arresting sites. Subunit A is transcriptionally active and its transcription activity is strongly enhanced by binding to the dimeric complex of the SIII regulatory subunits B and C (elongin BC complex) (PubMed : 7638163). In embryonic stem cells, the elongin BC complex is recruited by EPOP to Polycomb group (PcG) target genes in order generate genomic region that display both active and repressive chromatin properties, an important feature of pluripotent stem cells (By similarity).. Core component of multiple cullin-2 and cullin-5-RING E3 ubiquitin-protein ligase complexes (ECS complexes), which mediate the ubiquitination of target proteins (PubMed : 10205047, PubMed : 12004076, PubMed : 12050673, PubMed : 15590694, PubMed : 26138980, PubMed : 29775578, PubMed : 29779948, PubMed : 33268465, PubMed : 38326650). By binding to BC-box motifs it seems to link target recruitment subunits, like VHL and members of the SOCS box family, to Cullin/RBX1 modules that activate E2 ubiquitination enzymes (PubMed : 10205047, PubMed : 12004076, PubMed : 12050673, PubMed : 15590694). Component the von Hippel-Lindau ubiquitination complex CBC(VHL) (PubMed : 10205047, PubMed : 12004076, PubMed : 12050673, PubMed : 15590694). A number of ECS complexes (containing either KLHDC2, KLHDC3, KLHDC10, APPBP2, FEM1A, FEM1B or FEM1C as substrate-recognition component) are part of the DesCEND (destruction via C-end degrons) pathway, which recognizes a C-degron located at the extreme C terminus of target proteins, leading to their ubiquitination and degradation (PubMed : 26138980, PubMed : 29775578, PubMed : 29779948). The ECS(ASB9) complex mediates ubiquitination and degradation of CKB (PubMed : 33268465). As part of a multisubunit ubiquitin ligase complex, polyubiquitinates monoubiquitinated POLR2A (PubMed : 19920177). ECS(LRR1) ubiquitinates MCM7 and promotes CMG replisome disassembly by VCP and chromatin extraction during S-phase (By similarity).. (Microbial infection) Following infection by HIV-1 virus, component of a cullin-5-RING E3 ubiquitin-protein ligase complex (ECS complex) hijacked by the HIV-1 Vif protein, which catalyzes ubiquitination and degradation of APOBEC3F and APOBEC3G (PubMed : 18562529, PubMed : 20532212, PubMed : 22190037, PubMed : 24225024, PubMed : 24402281, PubMed : 36754086). The complex can also ubiquitinate APOBEC3H to some extent (PubMed : 37640699).
See full target information ELOB

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com