JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB114447

Recombinant Human TCF3 / E2A protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human TCF3 / E2A protein is a Human Fragment protein, in the 545 to 654 aa range, expressed in Wheat germ, suitable for SDS-PAGE, ELISA, WB.

View Alternative Names

BHLHB21, E2A, ITF1, TCF3, Transcription factor E2-alpha, Class B basic helix-loop-helix protein 21, Immunoglobulin enhancer-binding factor E12/E47, Immunoglobulin transcription factor 1, Kappa-E2-binding factor, Transcription factor 3, Transcription factor ITF-1, bHLHb21, TCF-3

1 Images
SDS-PAGE - Recombinant Human TCF3 / E2A protein (AB114447)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human TCF3 / E2A protein (AB114447)

ab114447 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

Tag free

Applications

WB, ELISA, SDS-PAGE

applications

Biologically active

No

Accession

P15923

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.3% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"EREKERRVANNARERLRVRDINEAFKELGRMCQLHLNSEKPQTKLLILHQAVSVILNLEQQVRERNLNPKAACLKRREEEKVSGVVGDPQMVLSAPHPGLSEAHNPAGHM","proteinLength":"Fragment","predictedMolecularWeight":"37.73 kDa","actualMolecularWeight":null,"aminoAcidEnd":654,"aminoAcidStart":545,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"P15923","tags":[]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The TCF3 protein also commonly known as E2A functions mechanistically as a transcription factor involved in the regulation of gene expression. It plays an important role in the initiation of transcription by binding to E-box sequences on DNA impacting the transcription of various target genes. The E2A protein has a molecular mass of approximately 68 kDa. You can find E2A expression in multiple tissues particularly within the lymphoid tissues where it is critical for lymphocyte development and function.
Biological function summary

TCF3/E2A is essential for proper cellular development and differentiation. It functions as part of a larger transcription complex and partners often with other transcription factors like HEB or E47. These interactions allow E2A to regulate diverse biological processes including B cell lineage commitment and neuronal development. The ability to influence these processes highlights E2A’s role in managing cellular fate and developmental outcomes.

Pathways

E2A participates actively in the Notch signaling and B-cell receptor signaling pathways. In the context of Notch signaling E2A interacts with proteins like NOTCH1 and RBPJ to influence cell lineage decisions. Meanwhile in the B-cell receptor signaling pathway E2A works closely with proteins such as PAX5 and EBF1 playing a part in B-lymphocyte proliferation and maturation. These pathways underline E2A's significant role in immune cell regulation and function.

E2A's activity holds importance in the context of lymphoblastic leukemia and neurodevelopmental disorders. Chromosomal translocations involving E2A such as the t(1;19) translocation associate with the development of acute lymphoblastic leukemia. These genetic changes can result in aberrant fusion proteins that disturb normal transcriptional regulation. E2A’s link to neurodevelopmental disorders emerges when its regulation becomes disrupted often involving proteins like NEUROD1 which partners with E2A in neural differentiation. This connection emphasizes E2A’s role in maintaining normal cellular and tissue functions.

Specifications

Form

Liquid

General info

Function

Transcriptional regulator involved in the initiation of neuronal differentiation and mesenchymal to epithelial transition (By similarity). Heterodimers between TCF3 and tissue-specific basic helix-loop-helix (bHLH) proteins play major roles in determining tissue-specific cell fate during embryogenesis, like muscle or early B-cell differentiation (By similarity). Together with TCF15, required for the mesenchymal to epithelial transition (By similarity). Dimers bind DNA on E-box motifs : 5'-CANNTG-3' (By similarity). Binds to the kappa-E2 site in the kappa immunoglobulin gene enhancer (PubMed : 2493990). Binds to IEB1 and IEB2, which are short DNA sequences in the insulin gene transcription control region (By similarity).. Isoform E47. Facilitates ATOH7 binding to DNA at the consensus sequence 5'-CAGGTG-3', and positively regulates transcriptional activity.

Post-translational modifications

Phosphorylated following NGF stimulation.. Undergoes Notch-induced ubiquitination and subsequent proteasomal degradation which is mediated by ASB1 or ASB2, the substrate-recognition components of probable ECS E3 ubiquitin-protein ligase complexes.

Subcellular localisation

Nucleus

Product protocols

Target data

Transcriptional regulator involved in the initiation of neuronal differentiation and mesenchymal to epithelial transition (By similarity). Heterodimers between TCF3 and tissue-specific basic helix-loop-helix (bHLH) proteins play major roles in determining tissue-specific cell fate during embryogenesis, like muscle or early B-cell differentiation (By similarity). Together with TCF15, required for the mesenchymal to epithelial transition (By similarity). Dimers bind DNA on E-box motifs : 5'-CANNTG-3' (By similarity). Binds to the kappa-E2 site in the kappa immunoglobulin gene enhancer (PubMed : 2493990). Binds to IEB1 and IEB2, which are short DNA sequences in the insulin gene transcription control region (By similarity).. Isoform E47. Facilitates ATOH7 binding to DNA at the consensus sequence 5'-CAGGTG-3', and positively regulates transcriptional activity.
See full target information TCF3

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com