JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB159659

Recombinant Human TCR V delta 1 protein (GST tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human TCR V delta 1 protein (GST tag N-Terminus) is a Human Fragment protein, in the 173 to 272 aa range, expressed in Wheat germ, suitable for ELISA, WB.

View Alternative Names

T cell receptor delta constant, TRDC

1 Images
SDS-PAGE - Recombinant Human TCR V delta 1 protein (GST tag N-Terminus) (AB159659)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human TCR V delta 1 protein (GST tag N-Terminus) (AB159659)

ab159659 on a 12.5% SDS-PAGE stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

WB, ELISA

applications

Biologically active

No

Accession

B7Z8K6

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"LVSSKKITEFDPAIVISPSGKYNAVKLGKYEDSNSVTCSVQHDNKTVHSTDFEVKTDSTDHVKPKETENTKQPSKSCHKPKAIVHTEKVNMMSLTVLGLR","proteinLength":"Fragment","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":272,"aminoAcidStart":173,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"B7Z8K6","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The TCR V delta 1 or T-cell receptor Vδ1 is a subunit of the gamma-delta T-cell receptor complex. This protein is important in recognizing antigens that are not processed and presented by MHC complexes. TCR V delta 1 weighs around 60 kDa and is mainly expressed on a subset of gamma-delta T cells primarily in mucosal tissues like the skin intestines and lungs. These locations allow it to participate in immune surveillance and responses against pathogens and cancer cells.
Biological function summary

TCR V delta 1 is integral to the function of gamma-delta T cells which play a unique role in the immune response by recognizing stressed cells and presenting non-peptide antigens. Unlike alpha-beta T cells gamma-delta T cells often involving TCR V delta 1 do not require antigen presentation via MHC molecules. Therefore they can respond faster to certain pathological conditions. TCR V delta 1 pairs with the gamma chain in the receptor complex influencing the activation and proliferation of these T cells and modulating immune responses.

Pathways

TCR V delta 1 participates in key immune processes such as the recognition of phosphoantigens and stress-induced ligands through pathways like the Vδ1 T cell activation pathway and TCR signaling. The protein works closely with signaling molecules like CD3 and proteins in the MAPK pathway which together regulate gamma-delta T cell activation survival and cytokine production. Through these pathways TCR V delta 1 contributes to antitumor immunity and the maintenance of tissue homeostasis.

TCR V delta 1 shows relevance in various conditions including cancer and autoimmune diseases. In some cancers like melanoma Vδ1 T cells through mechanisms related to TCR V delta 1 show potential in targeting and eliminating tumor cells. In autoimmune conditions such as celiac disease aberrant gamma-delta T cell responses can occur with TCR V delta 1 influencing the pathogenesis. Additionally interactions with proteins like NKG2D can influence these disease processes affecting how gamma-delta T cells either protect or exacerbate disease states.

Specifications

Form

Liquid

General info

Function

Constant region of T cell receptor (TR) delta chain that participates in the antigen recognition (PubMed : 24600447). Gamma-delta TRs recognize a variety of self and foreign non-peptide antigens frequently expressed at the epithelial boundaries between the host and external environment, including endogenous lipids presented by MH-like protein CD1D and phosphoantigens presented by butyrophilin-like molecule BTN3A1. Upon antigen recognition induces rapid, innate-like immune responses involved in pathogen clearance and tissue repair (PubMed : 23348415, PubMed : 28920588). Binding of gamma-delta TR complex to antigen triggers phosphorylation of immunoreceptor tyrosine-based activation motifs (ITAMs) in the CD3 chains by the LCK and FYN kinases, allowing the recruitment, phosphorylation, and activation of ZAP70 that facilitates phosphorylation of the scaffolding proteins LCP2 and LAT. This lead to the formation of a supramolecular signalosome that recruits the phospholipase PLCG1, resulting in calcium mobilization and ERK activation, ultimately leading to T cell expansion and differentiation into effector cells (PubMed : 25674089). Gamma-delta TRs are produced through somatic rearrangement of a limited repertoire of variable (V), diversity (D), and joining (J) genes. The potential diversity of gamma-delta TRs is conferred by the unique ability to rearrange (D) genes in tandem and to utilize all three reading frames. The combinatorial diversity is considerably increased by the sequence exonuclease trimming and random nucleotide (N) region additions which occur during the V-(D)-J rearrangements (PubMed : 24387714).

Product protocols

Target data

Constant region of T cell receptor (TR) delta chain that participates in the antigen recognition (PubMed : 24600447). Gamma-delta TRs recognize a variety of self and foreign non-peptide antigens frequently expressed at the epithelial boundaries between the host and external environment, including endogenous lipids presented by MH-like protein CD1D and phosphoantigens presented by butyrophilin-like molecule BTN3A1. Upon antigen recognition induces rapid, innate-like immune responses involved in pathogen clearance and tissue repair (PubMed : 23348415, PubMed : 28920588). Binding of gamma-delta TR complex to antigen triggers phosphorylation of immunoreceptor tyrosine-based activation motifs (ITAMs) in the CD3 chains by the LCK and FYN kinases, allowing the recruitment, phosphorylation, and activation of ZAP70 that facilitates phosphorylation of the scaffolding proteins LCP2 and LAT. This lead to the formation of a supramolecular signalosome that recruits the phospholipase PLCG1, resulting in calcium mobilization and ERK activation, ultimately leading to T cell expansion and differentiation into effector cells (PubMed : 25674089). Gamma-delta TRs are produced through somatic rearrangement of a limited repertoire of variable (V), diversity (D), and joining (J) genes. The potential diversity of gamma-delta TRs is conferred by the unique ability to rearrange (D) genes in tandem and to utilize all three reading frames. The combinatorial diversity is considerably increased by the sequence exonuclease trimming and random nucleotide (N) region additions which occur during the V-(D)-J rearrangements (PubMed : 24387714).
See full target information TRDC

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com