JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB106872

Recombinant Human TCTEX-1 protein (His tag N-Terminus)

Be the first to review this product! Submit a review

|

(1 Publication)

Recombinant Human TCTEX-1 protein (His tag N-Terminus) is a Human Full Length protein, in the 1 to 113 aa range, expressed in Escherichia coli, with >95%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

TCTEL1, TCTEX-1, TCTEX1, DYNLT1, Dynein light chain Tctex-type 1, Protein CW-1, T-complex testis-specific protein 1 homolog

1 Images
SDS-PAGE - Recombinant Human TCTEX-1 protein (His tag N-Terminus) (AB106872)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human TCTEX-1 protein (His tag N-Terminus) (AB106872)

15% SDS-PAGE analysis of 3μg ab106872.

Key facts

Purity

>95% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE, Mass Spec

applications

Biologically active

No

Accession

P63172

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 30% Glycerol (glycerin, glycerine), 0.58% Sodium chloride, 0.316% Tris HCl, 0.0154% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

This product was previously labelled as DYNLT1

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMEDYQAAEETAFVVDEVSNIVKEAIESAIGGNAYQHSKVNQWTTNVVEQTLSQLTKLGKPFKYIVTCVIMQKNGAGLHTASSCFWDSSTDGSCTVRWENKTMYCIVSAFGLSI","proteinLength":"Full Length","predictedMolecularWeight":"14.6 kDa","actualMolecularWeight":null,"aminoAcidEnd":113,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P63172","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

TCTEX-1 also known as DYNLT1 or DLC1 is a component of the cytoplasmic dynein motor protein complex. It has a molecular mass of approximately 14 kDa. This protein localizes mainly to the cytoplasm and is expressed in a variety of tissues including the brain and kidneys. TCTEX-1 interacts with other proteins to facilitate cellular transport along microtubules which are essential components of the cell’s cytoskeleton aiding in maintaining cell shape and facilitating organelle movement.
Biological function summary

The role of TCTEX-1 involves the transport of vesicles and other cargo within cells using the dynein motor complex. This protein is a light chain component of the dynein which is a cytoplasmic motor protein complex responsible for retrograde transport movement along microtubules. It ensures the efficient transfer of intracellular organelles playing an essential role in cellular organization and function.

Pathways

TCTEX-1's involvement spans the intracellular trafficking and signaling pathways. It participates significantly in the endocytic pathway working closely with proteins like dynein heavy chain to mediate the efficient movement of endosomes. TCTEX-1 is also linked to the Wnt signaling pathway where its association with microtubule dynamics assists in cell signaling processes and influences cellular responses.

TCTEX-1 shows associations with neurodegenerative diseases such as Alzheimer's disease. Disruption in its function can lead to impaired axonal transport contributing to the pathological development of neurodegeneration. Additionally aberrant expression of TCTEX-1 is connected to certain types of renal cancer where interactions with proteins like BCL2L2 can influence cell survival and apoptosis pathways in tumor cells.

Specifications

Form

Liquid

Additional notes

ab106872 is purified using conventional chromatography techniques.

General info

Function

Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. Binds to transport cargos and is involved in apical cargo transport such as rhodopsin-bearing vesicles in polarized epithelia. May also be a accessory component of axonemal dynein.. Plays a role in neuronal morphogenesis; the function is independent of cytoplasmic dynein and seems to be coupled to regulation of the actin cytoskeleton by enhancing Rac1 activity. The function in neurogenesis may be regulated by association with a G-protein beta-gamma dimer. May function as a receptor-independent activator of heterotrimeric G-protein signaling; the activation appears to be independent of a nucleotide exchange. Plays a role in regulating neurogenesis; inhibits the genesis of neurons from precursor cells during cortical development presumably by antagonizing ARHGEF2. Involved in the regulation of mitotic spindle orientation (By similarity). Unrelated to the role in retrograde microtubule-associated movement may play a role in the dimerization of cytoplasmic proteins/domains such as for ACVR2B. Binds to the cytoplasmic domain of ACVR2B and, in vitro, inhibits ACVR2B signaling (PubMed : 27502274).. (Microbial infection) Is involved in intracellular targeting of D-type retrovirus gag polyproteins to the cytoplasmic assembly site.

Sequence similarities

Belongs to the dynein light chain Tctex-type family.

Post-translational modifications

Phosphorylated by BMPR2; the phosphorylation is abolished by BMPR2 mutations in exon 12 which lead to truncated forms of BMPR2 and which are linked to primary pulmonary hypertension (PPH1) [MIM:178600]. The phosphorylation status is proposed to regulate the association with the cytoplasmic dynein complex and may have role in cytoplasmic dynein cargo release (By similarity).

Subcellular localisation

Cytoskeleton

Product protocols

Target data

Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. Binds to transport cargos and is involved in apical cargo transport such as rhodopsin-bearing vesicles in polarized epithelia. May also be a accessory component of axonemal dynein.. Plays a role in neuronal morphogenesis; the function is independent of cytoplasmic dynein and seems to be coupled to regulation of the actin cytoskeleton by enhancing Rac1 activity. The function in neurogenesis may be regulated by association with a G-protein beta-gamma dimer. May function as a receptor-independent activator of heterotrimeric G-protein signaling; the activation appears to be independent of a nucleotide exchange. Plays a role in regulating neurogenesis; inhibits the genesis of neurons from precursor cells during cortical development presumably by antagonizing ARHGEF2. Involved in the regulation of mitotic spindle orientation (By similarity). Unrelated to the role in retrograde microtubule-associated movement may play a role in the dimerization of cytoplasmic proteins/domains such as for ACVR2B. Binds to the cytoplasmic domain of ACVR2B and, in vitro, inhibits ACVR2B signaling (PubMed : 27502274).. (Microbial infection) Is involved in intracellular targeting of D-type retrovirus gag polyproteins to the cytoplasmic assembly site.
See full target information DYNLT1

Publications (1)

Recent publications for all applications. Explore the full list and refine your search

Science advances 11:eadn6796 PubMed40532013

2025

HIV-1 binds dynein directly to hijack microtubule transport machinery.

Applications

Unspecified application

Species

Unspecified reactive species

Somayesadat Badieyan,Drew Lichon,Sevnur Komurlu Keceli,Michael P Andreas,John P Gillies,Wang Peng,Jiong Shi,Morgan E DeSantis,Christopher R Aiken,Till Böcking,Tobias W Giessen,Edward M Campbell,Michael A Cianfrocco
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com