JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB140718

Recombinant Human TDP43 protein (His tag N-Terminus)

Be the first to review this product! Submit a review

|

(2 Publications)

Recombinant Human TDP43 protein (His tag N-Terminus) is a Human Fragment protein, in the 1 to 260 aa range, expressed in Escherichia coli, with >85%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

TDP43, TARDBP, TAR DNA-binding protein 43, TDP-43

1 Images
SDS-PAGE - Recombinant Human TDP43 protein (His tag N-Terminus) (AB140718)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human TDP43 protein (His tag N-Terminus) (AB140718)

15% SDS-PAGE analysis of ab140718 (3μg).

Key facts

Purity

>85% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE, Mass Spec

applications

Biologically active

No

Accession

Q13148

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 10% Glycerol (glycerin, glycerine), 0.58% Sodium chloride, 0.32% Tris HCl

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSMSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRYRNPVSQCMRGVRLVEGILHAPDAGWGNLVYVVNYPKDNKRKMDETDASSAVKVKRAVQKTSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQRHMIDGRWCDCKLPNSKQSQDEPLRSRKVFVGRCTEDMTEDELREFFSQYGDVMDVFIPKPFRAFAFVTFADDQIAQSLCGEDLIIKGISVHISNA","proteinLength":"Fragment","predictedMolecularWeight":"33.6 kDa","actualMolecularWeight":null,"aminoAcidEnd":260,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q13148","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

TDP43 also known as TAR DNA-binding protein 43 is a protein of approximately 43 kDa. It plays a role in various cellular processes primarily by binding to DNA and RNA. Researchers find TDP43 expressed mainly in neuronal tissues but it is present in other cell types as well. Known for its involvement in regulating gene expression and mRNA stability TDP43 interacts with other proteins within the nuclear compartment. The full function and activities of TDP43 are still under exploration but its importance in normal cellular functions is well recognized.
Biological function summary

TDP43 acts as a regulator of RNA splicing and transcription by forming ribonucleoprotein complexes. The protein can bind to specific sequences in RNA helping in the proper processing and transport of mRNA. Furthermore TDP43 has a role in stress granule formation a cell response to stress. Researchers have identified that the protein undergoes various post-translational modifications which could influence its behavior and function within the cellular environment.

Pathways

Several important pathways include TDP43 due to its functions in RNA metabolism. This protein contributes to the spliceosomal cycle and other pathways involved in mRNA processing. TDP43 interacts with proteins such as FUS and hnRNP which are also involved in RNA splicing and are essential for maintaining mRNA integrity. These relations make TDP43 an important player in regulating gene expression and protein synthesis.

The association of TDP43 with neurodegenerative diseases is significant. Its abnormal aggregation is linked to amyotrophic lateral sclerosis (ALS) and frontotemporal lobar degeneration (FTLD). In these diseases TDP43 forms insoluble inclusions within neurons and glial cells. This mislocalization and aggregation can disrupt normal cellular function leading to cell death. In the context of ALS TDP43 often associates with proteins like SOD1 which are implicated in disease pathogenesis highlighting its role in neurodegeneration.

Specifications

Form

Liquid

Additional notes

ab140718 is purified using conventional chromatography techniques.

General info

Function

RNA-binding protein that is involved in various steps of RNA biogenesis and processing (PubMed : 23519609). Preferentially binds, via its two RNA recognition motifs RRM1 and RRM2, to GU-repeats on RNA molecules predominantly localized within long introns and in the 3'UTR of mRNAs (PubMed : 23519609, PubMed : 24240615, PubMed : 24464995). In turn, regulates the splicing of many non-coding and protein-coding RNAs including proteins involved in neuronal survival, as well as mRNAs that encode proteins relevant for neurodegenerative diseases (PubMed : 21358640, PubMed : 29438978). Plays a role in maintaining mitochondrial homeostasis by regulating the processing of mitochondrial transcripts (PubMed : 28794432). Regulates also mRNA stability by recruiting CNOT7/CAF1 deadenylase on mRNA 3'UTR leading to poly(A) tail deadenylation and thus shortening (PubMed : 30520513). In response to oxidative insult, associates with stalled ribosomes localized to stress granules (SGs) and contributes to cell survival (PubMed : 19765185, PubMed : 23398327). Participates also in the normal skeletal muscle formation and regeneration, forming cytoplasmic myo-granules and binding mRNAs that encode sarcomeric proteins (PubMed : 30464263). Plays a role in the maintenance of the circadian clock periodicity via stabilization of the CRY1 and CRY2 proteins in a FBXL3-dependent manner (PubMed : 27123980). Negatively regulates the expression of CDK6 (PubMed : 19760257). Regulates the expression of HDAC6, ATG7 and VCP in a PPIA/CYPA-dependent manner (PubMed : 25678563).

Post-translational modifications

Hyperphosphorylated in hippocampus, neocortex, and spinal cord from individuals affected with ALS and FTLDU. Phosphorylated upon cellular stress.. Ubiquitinated in hippocampus, neocortex, and spinal cord from individuals affected with ALS and FTLDU.. Cleaved to generate C-terminal fragments in hippocampus, neocortex, and spinal cord from individuals affected with ALS and FTLDU.

Subcellular localisation

Nucleus

Product protocols

Target data

RNA-binding protein that is involved in various steps of RNA biogenesis and processing (PubMed : 23519609). Preferentially binds, via its two RNA recognition motifs RRM1 and RRM2, to GU-repeats on RNA molecules predominantly localized within long introns and in the 3'UTR of mRNAs (PubMed : 23519609, PubMed : 24240615, PubMed : 24464995). In turn, regulates the splicing of many non-coding and protein-coding RNAs including proteins involved in neuronal survival, as well as mRNAs that encode proteins relevant for neurodegenerative diseases (PubMed : 21358640, PubMed : 29438978). Plays a role in maintaining mitochondrial homeostasis by regulating the processing of mitochondrial transcripts (PubMed : 28794432). Regulates also mRNA stability by recruiting CNOT7/CAF1 deadenylase on mRNA 3'UTR leading to poly(A) tail deadenylation and thus shortening (PubMed : 30520513). In response to oxidative insult, associates with stalled ribosomes localized to stress granules (SGs) and contributes to cell survival (PubMed : 19765185, PubMed : 23398327). Participates also in the normal skeletal muscle formation and regeneration, forming cytoplasmic myo-granules and binding mRNAs that encode sarcomeric proteins (PubMed : 30464263). Plays a role in the maintenance of the circadian clock periodicity via stabilization of the CRY1 and CRY2 proteins in a FBXL3-dependent manner (PubMed : 27123980). Negatively regulates the expression of CDK6 (PubMed : 19760257). Regulates the expression of HDAC6, ATG7 and VCP in a PPIA/CYPA-dependent manner (PubMed : 25678563).
See full target information TARDBP

Publications (2)

Recent publications for all applications. Explore the full list and refine your search

The Journal of cell biology 223: PubMed38197897

2024

IκB kinase phosphorylates cytoplasmic TDP-43 and promotes its proteasome degradation.

Applications

Unspecified application

Species

Unspecified reactive species

Yohei Iguchi,Yuhei Takahashi,Jiayi Li,Kunihiko Araki,Yoshinobu Amakusa,Yu Kawakami,Kenta Kobayashi,Satoshi Yokoi,Masahisa Katsuno

Frontiers in molecular neuroscience 13:19 PubMed32132902

2020

Chaperone Mediated Autophagy Degrades TDP-43 Protein and Is Affected by TDP-43 Aggregation.

Applications

Unspecified application

Species

Unspecified reactive species

Fernando Ormeño,Juan Hormazabal,José Moreno,Felipe Riquelme,Javiera Rios,Alfredo Criollo,Amelina Albornoz,Iván E Alfaro,Mauricio Budini
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com