JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB152741

Recombinant Human TFE3 protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human TFE3 protein is a Human Fragment protein, in the 166 to 254 aa range, expressed in Wheat germ, suitable for SDS-PAGE, ELISA, WB.

View Alternative Names

BHLHE33, TFE3, Transcription factor E3, Class E basic helix-loop-helix protein 33, bHLHe33

1 Images
SDS-PAGE - Recombinant Human TFE3 protein (AB152741)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human TFE3 protein (AB152741)

12.5% SDS-PAGE analysis of ab152741 stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

ELISA, WB, SDS-PAGE

applications

Biologically active

No

Accession

P19532

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"RPPPAQVPREVLKVQTHLENPTRYHLQQARRQQVKQYLSTTLGPKLASQALTPPPGPASAQPLPAPEAAHTTGPTGSAPNSPMALLTIG","proteinLength":"Fragment","predictedMolecularWeight":"35.53 kDa","actualMolecularWeight":null,"aminoAcidEnd":254,"aminoAcidStart":166,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"P19532","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Specifications

Form

Liquid

General info

Function

Transcription factor that acts as a master regulator of lysosomal biogenesis and immune response (PubMed : 2338243, PubMed : 24448649, PubMed : 29146937, PubMed : 30733432, PubMed : 31672913, PubMed : 37079666). Specifically recognizes and binds E-box sequences (5'-CANNTG-3'); efficient DNA-binding requires dimerization with itself or with another MiT/TFE family member such as TFEB or MITF (PubMed : 24448649). Involved in the cellular response to amino acid availability by acting downstream of MTOR : in the presence of nutrients, TFE3 phosphorylation by MTOR promotes its inactivation (PubMed : 24448649, PubMed : 31672913, PubMed : 36608670). Upon starvation or lysosomal stress, inhibition of MTOR induces TFE3 dephosphorylation, resulting in transcription factor activity (PubMed : 24448649, PubMed : 31672913, PubMed : 36608670). Specifically recognizes and binds the CLEAR-box sequence (5'-GTCACGTGAC-3') present in the regulatory region of many lysosomal genes, leading to activate their expression, thereby playing a central role in expression of lysosomal genes (PubMed : 24448649). Maintains the pluripotent state of embryonic stem cells by promoting the expression of genes such as ESRRB; mTOR-dependent TFE3 cytosolic retention and inactivation promotes exit from pluripotency (By similarity). Required to maintain the naive pluripotent state of hematopoietic stem cell; mTOR-dependent cytoplasmic retention of TFE3 promotes the exit of hematopoietic stem cell from pluripotency (PubMed : 30733432). TFE3 activity is also involved in the inhibition of neuronal progenitor differentiation (By similarity). Acts as a positive regulator of browning of adipose tissue by promoting expression of target genes; mTOR-dependent phosphorylation promotes cytoplasmic retention of TFE3 and inhibits browning of adipose tissue (By similarity). In association with TFEB, activates the expression of CD40L in T-cells, thereby playing a role in T-cell-dependent antibody responses in activated CD4(+) T-cells and thymus-dependent humoral immunity (By similarity). Specifically recognizes the MUE3 box, a subset of E-boxes, present in the immunoglobulin enhancer (PubMed : 2338243). It also binds very well to a USF/MLTF site (PubMed : 2338243). Promotes TGF-beta-induced transcription of COL1A2; via its interaction with TSC22D1 at E-boxes in the gene proximal promoter (By similarity). May regulate lysosomal positioning in response to nutrient deprivation by promoting the expression of PIP4P1 (PubMed : 29146937).

Sequence similarities

Belongs to the MiT/TFE family.

Post-translational modifications

Sumoylated; does not affect dimerization with MITF.. Phosphorylation ar Ser-47 and Ser-321 by MTOR via non-canonical mTORC1 pathway regulates its stability and subcellular location, respectively (PubMed:21209915, PubMed:24448649, PubMed:30733432, PubMed:36608670). When nutrients are present, phosphorylation by MTOR at Ser-47 promotes ubiquitination by the SCF(BTRC) complex, followed by degradation (PubMed:36608670). When nutrients are present, phosphorylation by MTOR at Ser-321 also promotes association with 14-3-3/YWHA adapters and retention in the cytosol (PubMed:24448649, PubMed:30733432). Phosphorylation at Ser-47 plays a more critical role than phosphorylation at Ser-321 for TFE3 inactivation (PubMed:36608670). Inhibition of mTORC1, starvation and lysosomal disruption, promotes dephosphorylation and transcription factor activity (PubMed:30733432, PubMed:36608670).. Ubiquitinated by the SCF(BTRC) and SCF(FBXW11) complexes following phosphorylation at Ser-47 by MTOR, leading to its degradation by the proteasome.

Subcellular localisation

Nucleus

Product protocols

Target data

Transcription factor that acts as a master regulator of lysosomal biogenesis and immune response (PubMed : 2338243, PubMed : 24448649, PubMed : 29146937, PubMed : 30733432, PubMed : 31672913, PubMed : 37079666). Specifically recognizes and binds E-box sequences (5'-CANNTG-3'); efficient DNA-binding requires dimerization with itself or with another MiT/TFE family member such as TFEB or MITF (PubMed : 24448649). Involved in the cellular response to amino acid availability by acting downstream of MTOR : in the presence of nutrients, TFE3 phosphorylation by MTOR promotes its inactivation (PubMed : 24448649, PubMed : 31672913, PubMed : 36608670). Upon starvation or lysosomal stress, inhibition of MTOR induces TFE3 dephosphorylation, resulting in transcription factor activity (PubMed : 24448649, PubMed : 31672913, PubMed : 36608670). Specifically recognizes and binds the CLEAR-box sequence (5'-GTCACGTGAC-3') present in the regulatory region of many lysosomal genes, leading to activate their expression, thereby playing a central role in expression of lysosomal genes (PubMed : 24448649). Maintains the pluripotent state of embryonic stem cells by promoting the expression of genes such as ESRRB; mTOR-dependent TFE3 cytosolic retention and inactivation promotes exit from pluripotency (By similarity). Required to maintain the naive pluripotent state of hematopoietic stem cell; mTOR-dependent cytoplasmic retention of TFE3 promotes the exit of hematopoietic stem cell from pluripotency (PubMed : 30733432). TFE3 activity is also involved in the inhibition of neuronal progenitor differentiation (By similarity). Acts as a positive regulator of browning of adipose tissue by promoting expression of target genes; mTOR-dependent phosphorylation promotes cytoplasmic retention of TFE3 and inhibits browning of adipose tissue (By similarity). In association with TFEB, activates the expression of CD40L in T-cells, thereby playing a role in T-cell-dependent antibody responses in activated CD4(+) T-cells and thymus-dependent humoral immunity (By similarity). Specifically recognizes the MUE3 box, a subset of E-boxes, present in the immunoglobulin enhancer (PubMed : 2338243). It also binds very well to a USF/MLTF site (PubMed : 2338243). Promotes TGF-beta-induced transcription of COL1A2; via its interaction with TSC22D1 at E-boxes in the gene proximal promoter (By similarity). May regulate lysosomal positioning in response to nutrient deprivation by promoting the expression of PIP4P1 (PubMed : 29146937).
See full target information TFE3

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com