JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB202166

Recombinant Human THOC7 protein (His tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human THOC7 protein (His tag N-Terminus) is a Human Full Length protein, in the 1 to 204 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

NIF3L1BP1, THOC7, THO complex subunit 7, Functional spliceosome-associated protein 24, Ngg1-interacting factor 3-like protein 1-binding protein 1, hTREX30, fSAP24, NIF3L1-binding protein 1

1 Images
SDS-PAGE - Recombinant Human THOC7 protein (His tag N-Terminus) (AB202166)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human THOC7 protein (His tag N-Terminus) (AB202166)

15% SDS-PAGE analysis of 3 μg ab202166.

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE, Mass Spec

applications

Biologically active

No

Accession

Q6I9Y2

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.4 Constituents: PBS, 50% Glycerol (glycerin, glycerine), 0.02% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMGSMGAVTDDEVIRKRLLIDGDGAGDDRRINLLVKSFIKWCNSGSQEEGYSQYQRMLSTLSQCEFSMGKTLLVYDMNLREMENYEKIYKEIECSIAGAHEKIAECKKQILQAKRIRKNRQEYDALAKVIQHHPDRHETLKELEALGKELEHLSHIKESVEDKLELRRKQFHVLLSTIHELQQTLENDEKLSEVEEAQEASMETDPKP","proteinLength":"Full Length","predictedMolecularWeight":"26.1 kDa","actualMolecularWeight":null,"aminoAcidEnd":204,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q6I9Y2","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

THOC7 also known as Transcription Export Protein 7 or HPR1 homolog is a protein involved in the mRNA export process from the nucleus to the cytoplasm. This protein weighs approximately 16 kDa. THOC7 is typically expressed in various human tissues including the heart kidney and skeletal muscle. The protein forms part of a multicomponent protein complex called the THO complex which integrates into the TRanscription-Export (TREX) complex.
Biological function summary

THOC7 plays an important role in the stabilization and export of mRNA. Within the THO complex it contributes to maintaining RNA stability and is essential for efficient transcription elongation. It interacts closely with other components of the complex which ensures proper genomic expression regulation. During RNA processing THOC7's participation in the TREX complex is critical for attaching export-ready mRNA transcripts to the nuclear pore complex helping facilitate their export into the cytoplasm.

Pathways

THOC7's involvement in the mRNA export pathway is indispensable for maintaining transcription homeostasis. It is essential for the coupling of transcription and mRNA processing interacting with proteins like THOC5 and those in the Aly/REF export factor family. THOC7 also engages in the cellular process of mRNA surveillance ensuring that only correctly processed mRNA molecules reach the cytoplasm for translation.

THOC7's malfunction can lead to disruptions in mRNA processing which may associate with cancer and neurodegenerative diseases. Defects or mutations in THOC7 or its associated TREX complex components have been observed in certain cancer types contributing to the abnormal regulation of gene expression. In neurodegenerative disorders improper RNA metabolism linked to THOC7 dysfunction can lead to neuronal degradation highlighting connections with proteins like TDP-43 which play a role in these conditions.

Specifications

Form

Liquid

Additional notes

ab202166 was purified using conventional chromatography techniques.

General info

Function

Component of the THO subcomplex of the TREX complex which is thought to couple mRNA transcription, processing and nuclear export, and which specifically associates with spliced mRNA and not with unspliced pre-mRNA (PubMed : 15833825, PubMed : 15998806, PubMed : 17190602). Required for efficient export of polyadenylated RNA (PubMed : 23222130). Plays a key structural role in the oligomerization of the THO-DDX39B complex (PubMed : 33191911). TREX is recruited to spliced mRNAs by a transcription-independent mechanism, binds to mRNA upstream of the exon-junction complex (EJC) and is recruited in a splicing- and cap-dependent manner to a region near the 5' end of the mRNA where it functions in mRNA export to the cytoplasm via the TAP/NXF1 pathway (PubMed : 15833825, PubMed : 15998806, PubMed : 17190602).. (Microbial infection) The TREX complex is essential for the export of Kaposi's sarcoma-associated herpesvirus (KSHV) intronless mRNAs and infectious virus production.

Sequence similarities

Belongs to the THOC7 family.

Subcellular localisation

Nucleus

Product protocols

Target data

Component of the THO subcomplex of the TREX complex which is thought to couple mRNA transcription, processing and nuclear export, and which specifically associates with spliced mRNA and not with unspliced pre-mRNA (PubMed : 15833825, PubMed : 15998806, PubMed : 17190602). Required for efficient export of polyadenylated RNA (PubMed : 23222130). Plays a key structural role in the oligomerization of the THO-DDX39B complex (PubMed : 33191911). TREX is recruited to spliced mRNAs by a transcription-independent mechanism, binds to mRNA upstream of the exon-junction complex (EJC) and is recruited in a splicing- and cap-dependent manner to a region near the 5' end of the mRNA where it functions in mRNA export to the cytoplasm via the TAP/NXF1 pathway (PubMed : 15833825, PubMed : 15998806, PubMed : 17190602).. (Microbial infection) The TREX complex is essential for the export of Kaposi's sarcoma-associated herpesvirus (KSHV) intronless mRNAs and infectious virus production.
See full target information THOC7

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com