JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB152743

Recombinant Human Thyroglobulin protein (GST tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human Thyroglobulin protein (GST tag N-Terminus) is a Human Fragment protein, in the 2659 to 2768 aa range, expressed in Wheat germ, suitable for SDS-PAGE, ELISA, WB.

View Alternative Names

Thyroglobulin, Tg, TG

1 Images
SDS-PAGE - Recombinant Human Thyroglobulin protein (GST tag N-Terminus) (AB152743)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human Thyroglobulin protein (GST tag N-Terminus) (AB152743)

12.5% SDS-PAGE analysis of ab152743 stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

WB, ELISA, SDS-PAGE

applications

Biologically active

No

Accession

P01266

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"FSHFIRSGNPNYPYEFSRKVPTFATPWPDFVPRAGGENYKEFSELLPNRQGLKKADCSFWSKYISSLKTSADGAKGGQSAESEEEELTAGSGLREDLLSLQEPGSKTYSK","proteinLength":"Fragment","predictedMolecularWeight":"37.84 kDa","actualMolecularWeight":null,"aminoAcidEnd":2768,"aminoAcidStart":2659,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"P01266","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Thyroglobulin often abbreviated as Tg is a glycoprotein with a molecular mass of approximately 660 kDa. It is expressed primarily in the thyroid gland particularly within the follicular cells. This protein serves as a precursor for thyroid hormones such as thyroxine (T4) and triiodothyronine (T3). High thyroglobulin levels in the bloodstream can indicate altered thyroid function and clinicians frequently measure these levels for diagnostic purposes. Researchers have developed specific anti-thyroglobulin antibodies to facilitate the study and measurement of this protein in various contexts.
Biological function summary

Thyroglobulin plays a critical role in the synthesis and storage of thyroid hormones. It acts as a scaffold for iodination and hormone synthesis within the colloid of thyroid follicles. Thyroglobulin is not part of a protein complex; rather it undergoes iodination to form hormone precursors that later convert into active hormones. Anti-thyroglobulin antibodies can be used in research or diagnostic labs to detect the presence or concentration of thyroglobulin in serum samples. These antibodies help in understanding the nuances of thyroid hormone biosynthesis and in monitoring thyroid activity.

Pathways

Thyroglobulin is deeply involved in the thyroid hormone synthesis pathway a fundamental part of the endocrine system's operations. This process connects closely with the iodine metabolism pathway as iodine plays an essential role in hormone production. Thyroglobulin interacts indirectly with proteins like thyroid peroxidase which catalyzes iodination of thyroglobulin. The synthesis and release of thyroid hormones proceed through a carefully orchestrated sequence affecting many physiological processes including metabolism growth and development.

Thyroglobulin has associations with conditions such as thyroid cancer and autoimmune thyroid diseases. For instance elevated serum thyroglobulin can serve as a tumor marker in differentiated thyroid cancer. Anti-thyroglobulin antibodies are often present in autoimmune thyroid diseases like Hashimoto's thyroiditis where the body's immune system mistakenly targets thyroid proteins. Thyroid peroxidase antibodies are also common in these disorders indicating a shared autoimmune response against thyroid-specific antigens. Understanding these relationships aids in the diagnosis and management of thyroid-related conditions.

Specifications

Form

Liquid

General info

Function

Acts as a substrate for the production of iodinated thyroid hormones thyroxine (T4) and triiodothyronine (T3) (PubMed : 17532758, PubMed : 32025030). The synthesis of T3 and T4 involves iodination of selected tyrosine residues of TG/thyroglobulin followed by their oxidative coupling in the thyroid follicle lumen (PubMed : 32025030). Following TG re-internalization and lysosomal-mediated proteolysis, T3 and T4 are released from the polypeptide backbone leading to their secretion into the bloodstream (PubMed : 32025030). One dimer produces 7 thyroid hormone molecules (PubMed : 32025030).

Sequence similarities

Belongs to the type-B carboxylesterase/lipase family.

Post-translational modifications

Iodinated on tyrosine residues by TPO (PubMed:2760035, PubMed:32025030). There are 4 pairs of iodinated tyrosines used for coupling: acceptor Tyr-24 is coupled to donor Tyr-149 or Tyr-234, acceptor Tyr-2573 is coupled to donor Tyr-2540, acceptor Tyr-2766 in monomer 1 is coupled to donor Tyr-2766 in monomer 2 and acceptor Tyr-1310 in monomer 1 is coupled to donor Tyr-108 in monomer 2 (PubMed:32025030).. Sulfated tyrosines are desulfated during iodination.. Undergoes sequential proteolysis by cathepsins to release thyroxine (T4) and triiodothyronine (T3) hormones. In the thyroid follicle lumen, cross-linked TG (storage form) is solubilized by limited proteolysis mediated by cathepsins CTSB and/or CTSL. Partially cleaved TG is further processed by CTSK/cathepsin K and/or CTSL resulting in the release of T4. Following endocytosis, further processing occurs leading to the release of T3 and more T4 hormones.

Product protocols

Target data

Acts as a substrate for the production of iodinated thyroid hormones thyroxine (T4) and triiodothyronine (T3) (PubMed : 17532758, PubMed : 32025030). The synthesis of T3 and T4 involves iodination of selected tyrosine residues of TG/thyroglobulin followed by their oxidative coupling in the thyroid follicle lumen (PubMed : 32025030). Following TG re-internalization and lysosomal-mediated proteolysis, T3 and T4 are released from the polypeptide backbone leading to their secretion into the bloodstream (PubMed : 32025030). One dimer produces 7 thyroid hormone molecules (PubMed : 32025030).
See full target information Thyroglobulin

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com