JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB269054

Recombinant human TIE2 protein (Active)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant human TIE2 protein (Active) is a Human Fragment protein, in the 771 to 1124 aa range, expressed in Baculovirus infected Sf9 cells, with >80%, suitable for SDS-PAGE, FuncS.

View Alternative Names

CD202b, TIE2, VMCM, VMCM1, TEK, Angiopoietin-1 receptor, Endothelial tyrosine kinase, Tunica interna endothelial cell kinase, Tyrosine kinase with Ig and EGF homology domains-2, Tyrosine-protein kinase receptor TEK, Tyrosine-protein kinase receptor TIE-2, p140 TEK, hTIE2

2 Images
Functional Studies - Recombinant human TIE2 protein (Active) (AB269054)
  • FuncS

Supplier Data

Functional Studies - Recombinant human TIE2 protein (Active) (AB269054)

The specific activity of ab269054 was 10 nmol/min/mg in a kinase assay using Poly (4 : 1 Glu, Tyr) peptide as substrate.

SDS-PAGE - Recombinant human TIE2 protein (Active) (AB269054)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant human TIE2 protein (Active) (AB269054)

SDS-PAGE analysis of ab269054.

Key facts

Purity

>80% SDS-PAGE

Expression system

Baculovirus infected Sf9 cells

Tags

GST tag N-Terminus

Applications

SDS-PAGE, FuncS

applications

Biologically active

Yes

Biological activity

The specific activity of ab269054 was 10 nmol/min/mg in a kinase assay using Poly (4:1 Glu, Tyr) peptide as substrate.

Accession

Q02763

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.5 Constituents: 25% Glycerol (glycerin, glycerine), 0.87% Sodium chloride, 0.79% Tris HCl, 0.31% Glutathione, 0.004% (R*,R*)-1,4-Dimercaptobutan-2,3-diol, 0.003% EDTA, 0.002% PMSF

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"QLKRANVQRRMAQAFQNVREEPAVQFNSGTLALNRKVKNNPDPTIYPVLDWNDIKFQDVIGEGNFGQVLKARIKKDGLRMDAAIKRMKEYASKDDHRDFAGELEVLCKLGHHPNIINLLGACEHRGYLYLAIEYAPHGNLLDFLRKSRVLETDPAFAIANSTASTLSSQQLLHFAADVARGMDYLSQKQFIHRDLAARNILVGENYVAKIADFGLSRGQEVYVKKTMGRLPVRWMAIESLNYSVYTTNSDVWSYGVLLWEIVSLGGTPYCGMTCAELYEKLPQGYRLEKPLNCDDEVYDLMRQCWREKPYERPSFAQILVSLNRMLEERKTYVNTTLYEKFTYAGIDCSAEEAA","proteinLength":"Fragment","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":1124,"aminoAcidStart":771,"nature":"Recombinant","expressionSystem":"Baculovirus infected Sf9 cells","accessionNumber":"Q02763","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

TIE2 also known as TEK or CD202B is a receptor tyrosine kinase with a mass of approximately 145 kDa. It plays an important role in vascular development and maintenance. TIE2 is mainly expressed in endothelial cells which line the interior surface of blood vessels. It binds angiopoietins predominantly Angiopoietin-1 (Angpt1) influencing vascular stability and permeability. Researchers use TIE2 antibodies including anti-TIE and anti-clone to study its role and functions across various contexts.
Biological function summary

TIE2 plays a central role in angiogenesis and blood vessel maturation. It forms a receptor complex with other components to mediate its effects. This interaction mainly involves Angpt1 which binds to TIE2 stabilizing blood vessels and preserving their integrity. TIE2 also participates in cell survival and migration processes necessary for normal vascular function. Researchers often perform Angpt1 ELISA in bulk to quantify interactions involving TIE2 in experiments.

Pathways

TIE2 is important in the angiopoietin-TIE signaling pathway regulating vascular development. TIE2 is related to proteins such as Angpt1 which are centrally involved in this pathway. It also interacts with various signaling molecules including phosphatidylinositol-3-kinase (PI3K) which contributes to cell survival pathways. Alterations in the TIE2 signaling cascade can lead to aberrant angiogenesis and related pathologies.

TIE2 is implicated in several vascular diseases and cancer. Mutations or dysregulation of TIE2 can result in venous malformations and further compromise blood vessel integrity. In cancer TIE2 expression can influence tumor angiogenesis enhancing tumor growth and metastasis. TIE2 interacts with proteins like vascular endothelial growth factor (VEGF) which are involved in neovascularization and cancer progression. Understanding these interactions helps target therapeutic strategies in relevant diseases.

Specifications

Form

Liquid

Additional notes

Affinity purified.

General info

Function

Tyrosine-protein kinase that acts as a cell-surface receptor for ANGPT1, ANGPT2 and ANGPT4 and regulates angiogenesis, endothelial cell survival, proliferation, migration, adhesion and cell spreading, reorganization of the actin cytoskeleton, but also maintenance of vascular quiescence. Has anti-inflammatory effects by preventing the leakage of pro-inflammatory plasma proteins and leukocytes from blood vessels. Required for normal angiogenesis and heart development during embryogenesis. Required for post-natal hematopoiesis. After birth, activates or inhibits angiogenesis, depending on the context. Inhibits angiogenesis and promotes vascular stability in quiescent vessels, where endothelial cells have tight contacts. In quiescent vessels, ANGPT1 oligomers recruit TEK to cell-cell contacts, forming complexes with TEK molecules from adjoining cells, and this leads to preferential activation of phosphatidylinositol 3-kinase and the AKT1 signaling cascades. In migrating endothelial cells that lack cell-cell adhesions, ANGT1 recruits TEK to contacts with the extracellular matrix, leading to the formation of focal adhesion complexes, activation of PTK2/FAK and of the downstream kinases MAPK1/ERK2 and MAPK3/ERK1, and ultimately to the stimulation of sprouting angiogenesis. ANGPT1 signaling triggers receptor dimerization and autophosphorylation at specific tyrosine residues that then serve as binding sites for scaffold proteins and effectors. Signaling is modulated by ANGPT2 that has lower affinity for TEK, can promote TEK autophosphorylation in the absence of ANGPT1, but inhibits ANGPT1-mediated signaling by competing for the same binding site. Signaling is also modulated by formation of heterodimers with TIE1, and by proteolytic processing that gives rise to a soluble TEK extracellular domain. The soluble extracellular domain modulates signaling by functioning as decoy receptor for angiopoietins. TEK phosphorylates DOK2, GRB7, GRB14, PIK3R1; SHC1 and TIE1.

Sequence similarities

Belongs to the protein kinase superfamily. Tyr protein kinase family. Tie subfamily.

Post-translational modifications

Proteolytic processing leads to the shedding of the extracellular domain (soluble TIE-2 alias sTIE-2).. Autophosphorylated on tyrosine residues in response to ligand binding. Autophosphorylation occurs in trans, i.e. one subunit of the dimeric receptor phosphorylates tyrosine residues on the other subunit. Autophosphorylation occurs in a sequential manner, where Tyr-992 in the kinase activation loop is phosphorylated first, followed by autophosphorylation at Tyr-1108 and at additional tyrosine residues. ANGPT1-induced phosphorylation is impaired during hypoxia, due to increased expression of ANGPT2. Phosphorylation is important for interaction with GRB14, PIK3R1 and PTPN11. Phosphorylation at Tyr-1102 is important for interaction with SHC1, GRB2 and GRB7. Phosphorylation at Tyr-1108 is important for interaction with DOK2 and for coupling to downstream signal transduction pathways in endothelial cells. Dephosphorylated by PTPRB.. Ubiquitinated. The phosphorylated receptor is ubiquitinated and internalized, leading to its degradation.

Subcellular localisation

Cytoskeleton

Product protocols

Target data

Tyrosine-protein kinase that acts as a cell-surface receptor for ANGPT1, ANGPT2 and ANGPT4 and regulates angiogenesis, endothelial cell survival, proliferation, migration, adhesion and cell spreading, reorganization of the actin cytoskeleton, but also maintenance of vascular quiescence. Has anti-inflammatory effects by preventing the leakage of pro-inflammatory plasma proteins and leukocytes from blood vessels. Required for normal angiogenesis and heart development during embryogenesis. Required for post-natal hematopoiesis. After birth, activates or inhibits angiogenesis, depending on the context. Inhibits angiogenesis and promotes vascular stability in quiescent vessels, where endothelial cells have tight contacts. In quiescent vessels, ANGPT1 oligomers recruit TEK to cell-cell contacts, forming complexes with TEK molecules from adjoining cells, and this leads to preferential activation of phosphatidylinositol 3-kinase and the AKT1 signaling cascades. In migrating endothelial cells that lack cell-cell adhesions, ANGT1 recruits TEK to contacts with the extracellular matrix, leading to the formation of focal adhesion complexes, activation of PTK2/FAK and of the downstream kinases MAPK1/ERK2 and MAPK3/ERK1, and ultimately to the stimulation of sprouting angiogenesis. ANGPT1 signaling triggers receptor dimerization and autophosphorylation at specific tyrosine residues that then serve as binding sites for scaffold proteins and effectors. Signaling is modulated by ANGPT2 that has lower affinity for TEK, can promote TEK autophosphorylation in the absence of ANGPT1, but inhibits ANGPT1-mediated signaling by competing for the same binding site. Signaling is also modulated by formation of heterodimers with TIE1, and by proteolytic processing that gives rise to a soluble TEK extracellular domain. The soluble extracellular domain modulates signaling by functioning as decoy receptor for angiopoietins. TEK phosphorylates DOK2, GRB7, GRB14, PIK3R1; SHC1 and TIE1.
See full target information TEK

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com