JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB271767

Recombinant Human TIM 4 protein (Tagged)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human TIM 4 protein (Tagged) is a Human Fragment protein, in the 25 to 315 aa range, expressed in HEK 293 cells, with >90%, suitable for WB, SDS-PAGE.

View Alternative Names

TIM4, TIMD4, T-cell immunoglobulin and mucin domain-containing protein 4, TIMD-4, T-cell immunoglobulin mucin receptor 4, T-cell membrane protein 4, TIM-4

2 Images
SDS-PAGE - Recombinant Human TIM 4 protein (Tagged) (AB271767)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human TIM 4 protein (Tagged) (AB271767)

SDS-PAGE analysis of 4 μg ab271767.

This protein runs at a higher MW by SDS-PAGE due to glycosylation.

Western blot - Recombinant Human TIM 4 protein (Tagged) (AB271767)
  • WB

Supplier Data

Western blot - Recombinant Human TIM 4 protein (Tagged) (AB271767)

All lanes:

Western blot - Recombinant Human TIM 4 protein (Tagged) (ab271767) at 4 µg

false

Key facts

Purity

>90% SDS-PAGE

Expression system

HEK 293 cells

Tags

Avi tag C-Terminus His tag C-Terminus

Applications

WB, SDS-PAGE

applications

Biologically active

No

Accession

Q96H15

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.4 Constituents: 20% Glycerol (glycerin, glycerine), 0.64% Sodium chloride, 0.13% Sodium phosphate, 0.02% Potassium chloride

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p>This protein runs at a higher MW by SDS-PAGE due to glycosylation.</p>" } } }

Sequence info

[{"sequence":"ETVVTEVLGHRVTLPCLYSSWSHNSNSMCWGKDQCPYSGCKEALIRTDGMRVTSRKSAKYRLQGTIPRGDVSLTILNPSESDSGVYCCRIEVPGWFNDVKINVRLNLQRASTTTHRTATTTTRRTTTTSPTTTRQMTTTPAALPTTVVTTPDLTTGTPLQMTTIAVFTTANTCLSLTPSTLPEEATGLLTPEPSKEGPILTAESETVLPSDSWSSVESTSADTVLLTSKESKVWDLPSTSHVSMWKTSDSVSSPQPGASDTAVPEQNKTTKTGQMDGIPMSMKNEMPISQL","proteinLength":"Fragment","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":315,"aminoAcidStart":25,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"Q96H15","tags":[{"tag":"Avi","terminus":"C-Terminus"},{"tag":"His","terminus":"C-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

TIM 4 also known as T cell immunoglobulin and mucin domain 4 is a protein of significant interest in immunology. It belongs to the TIM family of proteins which includes TIM 1 TIM 2 and TIM 3. TIM 4 weighs approximately 70 kDa and is mainly expressed on antigen-presenting cells including dendritic cells and macrophages. This protein plays an important role in immune response through its ability to recognize phosphatidylserine on apoptotic cells facilitating their clearance.
Biological function summary

The function of TIM 4 extends to regulating immune homeostasis and tolerance. TIM 4 does not possess signaling motifs itself but often associates with other adaptor proteins to exert its biological effects. It acts independently or forms part of complexes that modulate cell signaling events influencing the outcome of immune responses. The protein plays important roles in maintaining the delicate balance of immune activation and suppression which is critical to preventing autoimmunity.

Pathways

TIM 4 interaction occurs in pathways like the phosphatidylserine-mediated phagocytosis pathway which involves clearance of apoptotic cells. TIM 4 engages with phosphatidylserine a process important to maintaining tissue homeostasis and preventing inflammation. It works alongside other proteins in similar pathways including TIM 3 where together they mediate distinct and overlapping cellular processes involved in immune regulation.

TIM 4 presents significant implications in conditions including autoimmune diseases and cancer. Aberrant expression or function of TIM 4 associates with autoimmune disorders where it may contribute to the insufficient clearance of apoptotic cells subsequently promoting autoimmunity. In cancer altered TIM 4 activity can influence tumor progression by affecting immune evasion mechanisms. As TIM 4 interacts with TIM 3 these proteins together play roles in the development and progression of these diseases.

Specifications

Form

Liquid

General info

Function

Phosphatidylserine receptor that plays different role in immune response including phagocytosis of apoptotic cells and T-cell regulation. Controls T-cell activation in a bimodal fashion, decreasing the activation of naive T-cells by inducing cell cycle arrest, while increasing proliferation of activated T-cells by activating AKT1 and ERK1/2 phosphorylations and subsequent signaling pathways (By similarity). Also plays a role in efferocytosis which is the process by which apoptotic cells are removed by phagocytic cells (PubMed : 32703939, PubMed : 34067457). Mechanistically, promotes the engulfment of apoptotic cells or exogenous particles by securing them to phagocytes through direct binding to phosphatidylserine present on apoptotic cells, while other engulfment receptors such as MERTK efficiently recognize apoptotic cells and mediate their ingestion (PubMed : 32640697). Additionally, promotes autophagy process by suppressing NLRP3 inflammasome activity via activation of LKB1/PRKAA1 pathway in a phosphatidylserine-dependent mechanism (By similarity).. (Microbial infection) Plays a positive role in exosome-mediated trafficking of HIV-1 virus and its entry into immune cells.

Sequence similarities

Belongs to the immunoglobulin superfamily. TIM family.

Product protocols

Target data

Phosphatidylserine receptor that plays different role in immune response including phagocytosis of apoptotic cells and T-cell regulation. Controls T-cell activation in a bimodal fashion, decreasing the activation of naive T-cells by inducing cell cycle arrest, while increasing proliferation of activated T-cells by activating AKT1 and ERK1/2 phosphorylations and subsequent signaling pathways (By similarity). Also plays a role in efferocytosis which is the process by which apoptotic cells are removed by phagocytic cells (PubMed : 32703939, PubMed : 34067457). Mechanistically, promotes the engulfment of apoptotic cells or exogenous particles by securing them to phagocytes through direct binding to phosphatidylserine present on apoptotic cells, while other engulfment receptors such as MERTK efficiently recognize apoptotic cells and mediate their ingestion (PubMed : 32640697). Additionally, promotes autophagy process by suppressing NLRP3 inflammasome activity via activation of LKB1/PRKAA1 pathway in a phosphatidylserine-dependent mechanism (By similarity).. (Microbial infection) Plays a positive role in exosome-mediated trafficking of HIV-1 virus and its entry into immune cells.
See full target information TIMD4

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com