JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB82104

Recombinant human TIMP1 protein

5

(2 Reviews)

|

(1 Publication)

Recombinant human TIMP1 protein is a Human Full Length protein, expressed in Escherichia coli, with >95%, suitable for SDS-PAGE, WB, FuncS.

View Alternative Names

CLGI, TIMP, TIMP1, Metalloproteinase inhibitor 1, Erythroid-potentiating activity, Fibroblast collagenase inhibitor, Tissue inhibitor of metalloproteinases 1, EPA, Collagenase inhibitor, TIMP-1

2 Images
Sandwich ELISA - Recombinant human TIMP1 protein (AB82104)
  • sELISA

Unknown

Sandwich ELISA - Recombinant human TIMP1 protein (AB82104)

Standard curve for TIMP1 (Analyte : ab82104); dilution range 1pg/ml to 1μg/ml using Capture Antibody Mouse monoclonal [2E7.1] to TIMP1 (ab28261) at 1μg/ml and Detector Antibody Rabbit polyclonal to TIMP1 - Carboxyterminal end (ab38978) at 0.5μg/ml.

Western blot - Recombinant human TIMP1 protein (AB82104)
  • WB

Unknown

Western blot - Recombinant human TIMP1 protein (AB82104)

All lanes:

Anti-TIMP1 antibody [102D1] (<a href='/en-us/products/unavailable/timp1-antibody-102d1-ab1827'>ab1827</a>) at 1 µg/mL

All lanes:

Western blot - Recombinant human TIMP1 protein (ab82104) at 0.01 µg

Secondary

All lanes:

Western blot - Goat Anti-Mouse IgG H&L (HRP) preadsorbed (<a href='/en-us/products/secondary-antibodies/goat-mouse-igg-h-l-hrp-preadsorbed-ab97040'>ab97040</a>) at 5000 µg/mL

true

Exposure time: 3min

Key facts

Purity

>95% SDS-PAGE

Expression system

Escherichia coli

Tags

Tag free

Applications

WB, SDS-PAGE, FuncS

applications

Biologically active

Yes

Biological activity

Biological Activity : TIMP1 activity was measured by its ability to inhibit human MMP1 induced hydrolysis of a chromogenic peptide substrate at room temperature. Half maximal inhibition was obtained at a TIMP1 concentration of approximately 0.5 μg/ml, when using an MMP1 concentration of 1.6 μg/ml.

Accession

P01033

Animal free

No

Carrier free

No

Species

Human

Reconstitution

Reconstitute in water

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p>ab82104 can be used as a WB positive control in conjunction with <a href='/en-us/products/unavailable/timp1-antibody-102d1-ab1827'>ab1827</a>.</p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1-1.0 mg/ml. Do not vortex (can be stored at 4C for up to 1 week).
For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at -20C to -80C.

Sequence info

[{"sequence":"CTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQSLRSQIA","proteinLength":"Full Length","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":0,"aminoAcidStart":0,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P01033","tags":[]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
A few weeks
Appropriate long-term storage conditions
-20°C
Storage information
Avoid freeze / thaw cycle
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Tissue Inhibitor of Metalloproteinase 1 (TIMP1) is a protein with a molecular mass of approximately 28 kDa. The protein inhibits metalloproteinases by binding to them preventing the breakdown of the extracellular matrix. This action regulates extracellular environment and tissue remodeling. TIMP1 is also known by the name Erythroid-Potentiating Activity (EPA). It is expressed in various tissues including the liver and the brain and can be found in high levels in the blood serum.
Biological function summary

TIMP1 plays several essential roles beyond inhibiting metalloproteinases. It supports cell proliferation and influences apoptosis. It is part of a larger TIMP family and does not function as part of a complex per se but interacts closely with matrix metalloproteinases (MMPs). By regulating MMP activity TIMP1 balances processes like tissue growth and inflammatory responses which are important for normal development and repair.

Pathways

TIMP1 participates in the regulation of the matrix metalloproteinase pathway impacting tissue homeostasis and repair. It closely associates with proteins such as MMP-9 and MMP-2 within this pathway. TIMP1 also plays a role in cytokine signaling pathways which influence immune responses by interacting with other signaling molecules and receptors that govern these pathways.

TIMP1's regulation of MMPs links it to cancer and cardiovascular disease progression. Overexpression of TIMP1 associates with tumor growth and metastasis where it can modulate interactions with other proteins like MMP-9 leading to altered tissue invasion and angiogenesis. Additionally TIMP1 imbalance connects to tissue fibrosis in cardiovascular disorders working in tandem with proteins such as MMP-2 which affects the structural remodeling and function of tissues within the cardiovascular system.

Specifications

Form

Lyophilized

Additional notes

Purity is greater than 95% by SDS-PAGE gel and HPLC analyses.Endotoxin level is less than 0.1 ng per µg (1EU/µg).

General info

Function

Metalloproteinase inhibitor that functions by forming one to one complexes with target metalloproteinases, such as collagenases, and irreversibly inactivates them by binding to their catalytic zinc cofactor. Acts on MMP1, MMP2, MMP3, MMP7, MMP8, MMP9, MMP10, MMP11, MMP12, MMP13 and MMP16. Does not act on MMP14. Also functions as a growth factor that regulates cell differentiation, migration and cell death and activates cellular signaling cascades via CD63 and ITGB1. Plays a role in integrin signaling. Mediates erythropoiesis in vitro; but, unlike IL3, it is species-specific, stimulating the growth and differentiation of only human and murine erythroid progenitors.

Sequence similarities

Belongs to the protease inhibitor I35 (TIMP) family.

Post-translational modifications

The activity of TIMP1 is dependent on the presence of disulfide bonds.. N-glycosylated.

Product protocols

Target data

Metalloproteinase inhibitor that functions by forming one to one complexes with target metalloproteinases, such as collagenases, and irreversibly inactivates them by binding to their catalytic zinc cofactor. Acts on MMP1, MMP2, MMP3, MMP7, MMP8, MMP9, MMP10, MMP11, MMP12, MMP13 and MMP16. Does not act on MMP14. Also functions as a growth factor that regulates cell differentiation, migration and cell death and activates cellular signaling cascades via CD63 and ITGB1. Plays a role in integrin signaling. Mediates erythropoiesis in vitro; but, unlike IL3, it is species-specific, stimulating the growth and differentiation of only human and murine erythroid progenitors.
See full target information TIMP1

Publications (1)

Recent publications for all applications. Explore the full list and refine your search

Human molecular genetics 26:1230-1246 PubMed28158775

2017

Therapeutic potential of AAV-mediated MMP-3 secretion from corneal endothelium in treating glaucoma.

Applications

Unspecified application

Species

Unspecified reactive species

Jeffrey O'Callaghan,Darragh E Crosbie,Paul S Cassidy,Joseph M Sherwood,Cassandra Flügel-Koch,Elke Lütjen-Drecoll,Marian M Humphries,Ester Reina-Torres,Deborah Wallace,Anna-Sophia Kiang,Matthew Campbell,W Daniel Stamer,Darryl R Overby,Colm O'Brien,Lawrence C S Tam,Peter Humphries
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com