JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB280945

Recombinant human TIMP1 protein (Active)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant human TIMP1 protein (Active) is a Human Full Length protein, in the 24 to 207 aa range, expressed in HEK 293 cells, with >95%, <0.005 EU/µg endotoxin level, suitable for SDS-PAGE, FuncS, Mass Spec, HPLC.

View Alternative Names

CLGI, TIMP, TIMP1, Metalloproteinase inhibitor 1, Erythroid-potentiating activity, Fibroblast collagenase inhibitor, Tissue inhibitor of metalloproteinases 1, EPA, Collagenase inhibitor, TIMP-1

4 Images
Mass Spectrometry - Recombinant human TIMP1 protein (Active) (AB280945)
  • Mass Spec

Supplier Data

Mass Spectrometry - Recombinant human TIMP1 protein (Active) (AB280945)

Mass determination by ESI-TOF.

Predicted MW is 20708.83 (+/-10 Da by ESI-TOF). Observed MW is 210723.10. Peak at 21033.40 is due to 2 O-galactose.

Functional Studies - Recombinant human TIMP1 protein (Active) (AB280945)
  • FuncS

Supplier Data

Functional Studies - Recombinant human TIMP1 protein (Active) (AB280945)

Functional analysis of ab280945.

Fully active determined by its ability to inhibit human MMP2 cleavage of a chromogenic peptide substrate (Mca-PLG-Dpa-AR-NH2).

ED50 is ≤9.7 ng/ml, corresponding to a specific activity of 1.03 x 105 units/mg.

Cell based assay testing is performed on the first lot of protein only and is provided as a reference for protein activity; subsequent lots of protein must pass all biophysical quality control parameters that meet the same parameters as the first lot.

Lot : GR3381129-1

HPLC - Recombinant human TIMP1 protein (Active) (AB280945)
  • HPLC

Supplier Data

HPLC - Recombinant human TIMP1 protein (Active) (AB280945)

HPLC analysis of ab280945.

SDS-PAGE - Recombinant human TIMP1 protein (Active) (AB280945)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant human TIMP1 protein (Active) (AB280945)

SDS-PAGE analysis of ab280945.

Key facts

Purity

>95% SDS-PAGE

Endotoxin level

<0.005 EU/µg

Expression system

HEK 293 cells

Tags

Tag free

Applications

SDS-PAGE, HPLC, FuncS, Mass Spec

applications

Biologically active

Yes

Biological activity

Fully active determined by its ability to inhibit human MMP2 cleavage of a chromogenic peptide substrate (Mca-PLG-Dpa-AR-NH2).

ED50 is ≤9.7 ng/ml, corresponding to a specific activity of 1.03 x 105 units/mg.

Accession

P01033

Animal free

Yes

Carrier free

No

Species

Human

Reconstitution

Reconstitute in PBS

Storage buffer

pH: 7.4 Constituents: 10.26% Trehalose, 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Potassium phosphate monobasic

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "HPLC": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"CTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQSLRSQIA","proteinLength":"Full Length","predictedMolecularWeight":"20.71 kDa","actualMolecularWeight":"20.72 kDa","aminoAcidEnd":207,"aminoAcidStart":24,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"P01033","tags":[]}]

Properties and storage information

Shipped at conditions
Ambient - Can Ship with Ice
Appropriate short-term storage conditions
Ambient
Appropriate long-term storage conditions
Ambient
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Tissue Inhibitor of Metalloproteinase 1 (TIMP1) is a protein with a molecular mass of approximately 28 kDa. The protein inhibits metalloproteinases by binding to them preventing the breakdown of the extracellular matrix. This action regulates extracellular environment and tissue remodeling. TIMP1 is also known by the name Erythroid-Potentiating Activity (EPA). It is expressed in various tissues including the liver and the brain and can be found in high levels in the blood serum.
Biological function summary

TIMP1 plays several essential roles beyond inhibiting metalloproteinases. It supports cell proliferation and influences apoptosis. It is part of a larger TIMP family and does not function as part of a complex per se but interacts closely with matrix metalloproteinases (MMPs). By regulating MMP activity TIMP1 balances processes like tissue growth and inflammatory responses which are important for normal development and repair.

Pathways

TIMP1 participates in the regulation of the matrix metalloproteinase pathway impacting tissue homeostasis and repair. It closely associates with proteins such as MMP-9 and MMP-2 within this pathway. TIMP1 also plays a role in cytokine signaling pathways which influence immune responses by interacting with other signaling molecules and receptors that govern these pathways.

TIMP1's regulation of MMPs links it to cancer and cardiovascular disease progression. Overexpression of TIMP1 associates with tumor growth and metastasis where it can modulate interactions with other proteins like MMP-9 leading to altered tissue invasion and angiogenesis. Additionally TIMP1 imbalance connects to tissue fibrosis in cardiovascular disorders working in tandem with proteins such as MMP-2 which affects the structural remodeling and function of tissues within the cardiovascular system.

Specifications

Form

Lyophilized

Additional notes

=95%  by HPLC

General info

Function

Metalloproteinase inhibitor that functions by forming one to one complexes with target metalloproteinases, such as collagenases, and irreversibly inactivates them by binding to their catalytic zinc cofactor. Acts on MMP1, MMP2, MMP3, MMP7, MMP8, MMP9, MMP10, MMP11, MMP12, MMP13 and MMP16. Does not act on MMP14. Also functions as a growth factor that regulates cell differentiation, migration and cell death and activates cellular signaling cascades via CD63 and ITGB1. Plays a role in integrin signaling. Mediates erythropoiesis in vitro; but, unlike IL3, it is species-specific, stimulating the growth and differentiation of only human and murine erythroid progenitors.

Sequence similarities

Belongs to the protease inhibitor I35 (TIMP) family.

Post-translational modifications

The activity of TIMP1 is dependent on the presence of disulfide bonds.. N-glycosylated.

Product protocols

Target data

Metalloproteinase inhibitor that functions by forming one to one complexes with target metalloproteinases, such as collagenases, and irreversibly inactivates them by binding to their catalytic zinc cofactor. Acts on MMP1, MMP2, MMP3, MMP7, MMP8, MMP9, MMP10, MMP11, MMP12, MMP13 and MMP16. Does not act on MMP14. Also functions as a growth factor that regulates cell differentiation, migration and cell death and activates cellular signaling cascades via CD63 and ITGB1. Plays a role in integrin signaling. Mediates erythropoiesis in vitro; but, unlike IL3, it is species-specific, stimulating the growth and differentiation of only human and murine erythroid progenitors.
See full target information TIMP1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com