JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB164054

Recombinant Human TIPE2 protein

Be the first to review this product! Submit a review

|

(1 Publication)

Recombinant Human TIPE2 protein is a Human Full Length protein, in the 1 to 184 aa range, expressed in Wheat germ, suitable for ELISA, WB.

View Alternative Names

Tumor necrosis factor alpha-induced protein 8-like protein 2, TIPE2, TNF alpha-induced protein 8-like protein 2, TNFAIP8-like protein 2, Inflammation factor protein 20, TNFAIP8L2

1 Images
SDS-PAGE - Recombinant Human TIPE2 protein (AB164054)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human TIPE2 protein (AB164054)

ab164054 on a 12.5% SDS-PAGE stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

ELISA, WB

applications

Biologically active

No

Accession

Q6P589

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

This product was previously labelled as Tumor necrosis factor alpha-induced protein 8-like protein 2.

Sequence info

[{"sequence":"MESFSSKSLALQAEKKLLSKMAGRSVAHLFIDETSSEVLDELYRVSKEYTHSRPQAQRVIKDLIKVAIKVAVLHRNGSFGPSELALATRFRQKLRQGAMTALSFGEVDFTFEAAVLAGLLTECRDVLLELVEHHLTPKSHGRIRHVFDHFSDPGLLTALYGPDFTQHLGKICDGLRKLLDEGKL","proteinLength":"Full Length","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":184,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"Q6P589","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

TIPE2 also known as TNFAIP8L2 is a member of the TNFAIP8 family of proteins with a molecular mass of approximately 23 kDa. Mechanically TIPE2 acts as a regulator of cell death and survival processes playing a role in modulating immune responses. It is expressed in a variety of tissues but particularly abundant in immune-related cells such as macrophages and lymphocytes. The protein influences signaling pathways by interacting with other molecules in the cell affecting downstream responses.
Biological function summary

TIPE2 functions as a negative regulator of immune signaling pathways providing a check against excessive immune activation. It is a cytosolic protein that does not form part of a larger protein complex but can interact with membrane-associated signaling proteins. TIPE2 inhibits both NF-kB and MAPK signaling pathways which are important in mediating immune responses and inflammation. This regulatory function is essential for maintaining immune homeostasis and preventing inflammatory disorders.

Pathways

Research has highlighted that TIPE2 is integrated within immune signaling cascades particularly impacting the NF-kB and MAPK pathways. These pathways play pivotal roles in inflammation and immune system activation. TIPE2 acts to inhibit the activation of proteins like IKK and JNK which are key mediators within these pathways. By suppressing these pathways TIPE2 helps to balance immune responses and prevent overactivation that can lead to disease states.

TIPE2 has been associated with autoimmune diseases and cancer. Insufficient TIPE2 expression or function can lead to autoimmune disorders like rheumatoid arthritis where unchecked immune signaling causes tissue damage. Conversely overexpression might contribute to cancer progression by dampening anti-tumor immune responses. TIPE2’s interaction with TNFAIP8 family proteins has shown implications in tumor progression highlighting its dual role in modulating immune responses and potential for therapeutic targeting.

Specifications

Form

Liquid

General info

Function

Acts as a negative regulator of innate and adaptive immunity by maintaining immune homeostasis (PubMed : 27043859). Plays a regulatory role in the Toll-like signaling pathway by determining the strength of LPS-induced signaling and gene expression (PubMed : 32188758). Inhibits TCR-mediated T-cell activation and negatively regulate T-cell function to prevent hyperresponsiveness (By similarity). Inhibits also autolysosome formation via negatively modulating MTOR activation by interacting with RAC1 and promoting the disassociation of the RAC1-MTOR complex (PubMed : 32460619). Plays an essential role in NK-cell biology by acting as a checkpoint and displaying an expression pattern correlating with NK-cell maturation process and by negatively regulating NK-cell maturation and antitumor immunity (By similarity). Mechanistically, suppresses IL-15-triggered mTOR activity in NK-cells (By similarity).

Sequence similarities

Belongs to the TNFAIP8 family. TNFAIP8L2 subfamily.

Post-translational modifications

Phosphorylated by TAK1/MAP3K7; this phosphorylation triggers association with BTRC and subsequent ubiquitination and degradation.. Ubiquitinated in a BTRC-depdent manner; leading to degradation mediated through the proteasome pathway.

Product protocols

Target data

Acts as a negative regulator of innate and adaptive immunity by maintaining immune homeostasis (PubMed : 27043859). Plays a regulatory role in the Toll-like signaling pathway by determining the strength of LPS-induced signaling and gene expression (PubMed : 32188758). Inhibits TCR-mediated T-cell activation and negatively regulate T-cell function to prevent hyperresponsiveness (By similarity). Inhibits also autolysosome formation via negatively modulating MTOR activation by interacting with RAC1 and promoting the disassociation of the RAC1-MTOR complex (PubMed : 32460619). Plays an essential role in NK-cell biology by acting as a checkpoint and displaying an expression pattern correlating with NK-cell maturation process and by negatively regulating NK-cell maturation and antitumor immunity (By similarity). Mechanistically, suppresses IL-15-triggered mTOR activity in NK-cells (By similarity).
See full target information TNFAIP8L2

Publications (1)

Recent publications for all applications. Explore the full list and refine your search

Neurochemical research 47:3167-3177 PubMed35842555

2022

Exogenous TIPE2 Inhibit TAK1 to Improve Inflammation and Neuropathic Pain Induced by Sciatic Nerve Injury Through Inactivating NF-κB and JNK.

Applications

Unspecified application

Species

Unspecified reactive species

Xuehua Sun,Xinyou Li,Youfei Zhou,Yufei Wang,Xiaochen Liu
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com