JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB159715

Recombinant Human TLR2 protein (GST tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human TLR2 protein (GST tag N-Terminus) is a Human Fragment protein, in the 121 to 220 aa range, expressed in Wheat germ, suitable for ELISA, WB.

View Alternative Names

CD282, TIL4, TLR2, Toll-like receptor 2, Toll/interleukin-1 receptor-like protein 4

1 Images
SDS-PAGE - Recombinant Human TLR2 protein (GST tag N-Terminus) (AB159715)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human TLR2 protein (GST tag N-Terminus) (AB159715)

ab159715 on a 12.5% SDS-PAGE stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

ELISA, WB

applications

Biologically active

No

Accession

O60603

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"KPLSSLTFLNLLGNPYKTLGETSLFSHLTKLQILRVGNMDTFTKIQRKDFAGLTFLEELEIDASDLQSYEPKSLKSIQNVSHLILHMKQHILLLEIFVDV","proteinLength":"Fragment","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":220,"aminoAcidStart":121,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"O60603","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Toll-like receptor 2 (TLR2) also called CD282 is a protein that detects molecules from bacteria and fungi. It has a mass of about 90 kDa. TLR2 is expressed on the surface of immune cells such as monocytes macrophages and neutrophils. This receptor recognizes pathogen-associated molecular patterns (PAMPs) and activates the immune response.
Biological function summary

TLR2 initiates signaling pathways that lead to the production of cytokines and chemokines helping to control infection. It forms dimers with other TLRs like TLR1 or TLR6 to expand its recognition range of microbial components. TLR2's activity is important for balancing pathogen recognition and avoiding overactive immune response. On macrophages TLR2 activation enhances their phagocytic ability.

Pathways

TLR2 plays roles in innate immune signaling pathways and inflammation pathways. It contributes significantly to the NF-kB and MAPK pathways which regulate inflammation and immune response. TLR2 often cooperates with proteins like MyD88 and TRAF6 in these pathways leading to downstream activation of transcription factors and production of pro-inflammatory molecules.

TLR2 is associated with inflammatory and infectious diseases including sepsis and tuberculosis. During tuberculosis interactions between TLR2 and its ligands trigger immune responses that are important for bacterial control. Additionally TLR2’s overactivation links to sepsis by causing excessive inflammation. Researchers study TLR2 for potential therapeutic targeting in these diseases assessing how modulation can improve outcomes or reduce detrimental inflammation.

Specifications

Form

Liquid

General info

Function

Cooperates with LY96 to mediate the innate immune response to bacterial lipoproteins and other microbial cell wall components. Cooperates with TLR1 or TLR6 to mediate the innate immune response to bacterial lipoproteins or lipopeptides (PubMed : 17889651, PubMed : 21078852). Acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response. May also activate immune cells and promote apoptosis in response to the lipid moiety of lipoproteins (PubMed : 10426995, PubMed : 10426996). Recognizes mycoplasmal macrophage-activating lipopeptide-2kD (MALP-2), soluble tuberculosis factor (STF), phenol-soluble modulin (PSM) and B.burgdorferi outer surface protein A lipoprotein (OspA-L) cooperatively with TLR6 (PubMed : 11441107). Stimulation of monocytes in vitro with M.tuberculosis PstS1 induces p38 MAPK and ERK1/2 activation primarily via this receptor, but also partially via TLR4 (PubMed : 16622205). MAPK activation in response to bacterial peptidoglycan also occurs via this receptor (PubMed : 16622205). Acts as a receptor for M.tuberculosis lipoproteins LprA, LprG, LpqH and PstS1, some lipoproteins are dependent on other coreceptors (TLR1, CD14 and/or CD36); the lipoproteins act as agonists to modulate antigen presenting cell functions in response to the pathogen (PubMed : 19362712). M.tuberculosis HSP70 (dnaK) but not HSP65 (groEL-2) acts via this protein to stimulate NF-kappa-B expression (PubMed : 15809303). Recognizes M.tuberculosis major T-antigen EsxA (ESAT-6) which inhibits downstream MYD88-dependent signaling (shown in mouse) (By similarity). Forms activation clusters composed of several receptors depending on the ligand, these clusters trigger signaling from the cell surface and subsequently are targeted to the Golgi in a lipid-raft dependent pathway. Forms the cluster TLR2 : TLR6 : CD14 : CD36 in response to diacylated lipopeptides and TLR2 : TLR1 : CD14 in response to triacylated lipopeptides (PubMed : 16880211). Required for normal uptake of M.tuberculosis, a process that is inhibited by M.tuberculosis LppM (By similarity).

Sequence similarities

Belongs to the Toll-like receptor family.

Post-translational modifications

Glycosylation of Asn-442 is critical for secretion of the N-terminal ectodomain of TLR2.. Ubiquitinated at Lys-754 by PPP1R11, leading to its degradation (PubMed:27805901). Deubiquitinated by USP2 (By similarity).

Product protocols

Target data

Cooperates with LY96 to mediate the innate immune response to bacterial lipoproteins and other microbial cell wall components. Cooperates with TLR1 or TLR6 to mediate the innate immune response to bacterial lipoproteins or lipopeptides (PubMed : 17889651, PubMed : 21078852). Acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response. May also activate immune cells and promote apoptosis in response to the lipid moiety of lipoproteins (PubMed : 10426995, PubMed : 10426996). Recognizes mycoplasmal macrophage-activating lipopeptide-2kD (MALP-2), soluble tuberculosis factor (STF), phenol-soluble modulin (PSM) and B.burgdorferi outer surface protein A lipoprotein (OspA-L) cooperatively with TLR6 (PubMed : 11441107). Stimulation of monocytes in vitro with M.tuberculosis PstS1 induces p38 MAPK and ERK1/2 activation primarily via this receptor, but also partially via TLR4 (PubMed : 16622205). MAPK activation in response to bacterial peptidoglycan also occurs via this receptor (PubMed : 16622205). Acts as a receptor for M.tuberculosis lipoproteins LprA, LprG, LpqH and PstS1, some lipoproteins are dependent on other coreceptors (TLR1, CD14 and/or CD36); the lipoproteins act as agonists to modulate antigen presenting cell functions in response to the pathogen (PubMed : 19362712). M.tuberculosis HSP70 (dnaK) but not HSP65 (groEL-2) acts via this protein to stimulate NF-kappa-B expression (PubMed : 15809303). Recognizes M.tuberculosis major T-antigen EsxA (ESAT-6) which inhibits downstream MYD88-dependent signaling (shown in mouse) (By similarity). Forms activation clusters composed of several receptors depending on the ligand, these clusters trigger signaling from the cell surface and subsequently are targeted to the Golgi in a lipid-raft dependent pathway. Forms the cluster TLR2 : TLR6 : CD14 : CD36 in response to diacylated lipopeptides and TLR2 : TLR1 : CD14 in response to triacylated lipopeptides (PubMed : 16880211). Required for normal uptake of M.tuberculosis, a process that is inhibited by M.tuberculosis LppM (By similarity).
See full target information TLR2

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com