JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB233665

Recombinant human TLR4 protein (Active)

Be the first to review this product! Submit a review

|

(5 Publications)

Recombinant human TLR4 protein (Active) is a Human Fragment protein, in the 24 to 632 aa range, expressed in HEK 293 cells, with >95%, suitable for SDS-PAGE, FuncS, HPLC.

View Alternative Names

CD284, Toll-like receptor 4, hToll, TLR4

Key facts

Purity

>95% SDS-PAGE

Expression system

HEK 293 cells

Tags

Tag free

Applications

HPLC, FuncS, SDS-PAGE

applications

Biologically active

Yes

Biological activity

Determined by its ability to bind rhMD-2 in a functional ELISA.

Accession

O00206

Animal free

No

Carrier free

No

Species

Human

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "HPLC": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

Migrates with an apparent molecular mass of approximately 90-100 kDa by SDS-PAGE gel, under reducing and non-reducing conditions.

Sequence info

[{"sequence":"ESWEPCVEVVPNITYQCMELNFYKIPDNLPFSTKNLDLSFNPLRHLGSYSFFSFPELQVLDLSRCEIQTIEDGAYQSLSHLSTLILTGNPIQSLALGAFSGLSSLQKLVAVETNLASLENFPIGHLKTLKELNVAHNLIQSFKLPEYFSNLTNLEHLDLSSNKIQSIYCTDLRVLHQMPLLNLSLDLSLNPMNFIQPGAFKEIRLHKLTLRNNFDSLNVMKTCIQGLAGLEVHRLVLGEFRNEGNLEKFDKSALEGLCNLTIEEFRLAYLDYYLDDIIDLFNCLTNVSSFSLVSVTIERVKDFSYNFGWQHLELVNCKFGQFPTLKLKSLKRLTFTSNKGGNAFSEVDLPSLEFLDLSRNGLSFKGCCSQSDFGTTSLKYLDLSFNGVITMSSNFLGLEQLEHLDFQHSNLKQMSEFSVFLSLRNLIYLDISHTHTRVAFNGIFNGLSSLEVLKMAGNSFQENFLPDIFTELRNLTFLDLSQCQLEQLSPTAFNSLSSLQVLNMSHNNFFSLDTFPYKCLNSLQVLDYSLNHIMTSKKQELQHFPSSLAFLNLTQNDFACTCEHQSFLQWIKDQRQLLVEVERMECATPSDKQGMPVLSLNITCQMNKT","proteinLength":"Fragment","predictedMolecularWeight":"69.3 kDa","actualMolecularWeight":null,"aminoAcidEnd":632,"aminoAcidStart":24,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"O00206","tags":[]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Toll-like receptor 4 (TLR4) is a membrane protein involved in the innate immune response. It serves as a receptor that recognizes pathogen-associated molecular patterns such as lipopolysaccharides from bacterial cell walls. Often referred to by its alternate names TLR-2 and CD284 this protein has a molecular weight of approximately 95 kDa. TLR4 is mainly expressed on the surface of immune cells like macrophages and dendritic cells enabling these cells to detect and respond to microbial invaders effectively.
Biological function summary

TLR4 plays an important role in activating the immune system. It forms a complex with myeloid differentiation factor 2 (MD-2) to facilitate binding to its ligands. Upon activation TLR4 triggers a signaling cascade that leads to the release of pro-inflammatory cytokines and interferons which are important for initiating the immune response. This early detection mechanism alerts the immune system to the presence of pathogens allowing the body to mount a defense.

Pathways

TLR4 participates in the nuclear factor kappa-light-chain-enhancer of activated B cells (NF-κB) and mitogen-activated protein kinase (MAPK) signaling pathways. These pathways are central to the inflammatory response with TLR4 acting as a sensor that activates downstream components like the MyD88 and TRIF proteins. These interactions result in the expression of genes that produce cytokines and enzymes involved in inflammation and immunity.

TLR4 has been implicated in the development of sepsis and atherosclerosis. In sepsis TLR4 recognizes lipopolysaccharides from bacterial infections which can cause excessive inflammation if uncontrolled. In atherosclerosis TLR4 receptors on vascular cells respond to endogenous ligands such as oxidized low-density lipoproteins contributing to plaque formation. The TLR4 interaction with proteins like CD14 and MD-2 is significant as it influences the inflammatory pathways that exacerbate these conditions.

Specifications

Form

Lyophilized

Additional notes

>= 95% by HPLC analysis.

General info

Function

Transmembrane receptor that functions as a pattern recognition receptor recognizing pathogen- and damage-associated molecular patterns (PAMPs and DAMPs) to induce innate immune responses via downstream signaling pathways (PubMed : 10835634, PubMed : 15809303, PubMed : 16622205, PubMed : 17292937, PubMed : 17478729, PubMed : 20037584, PubMed : 20711192, PubMed : 23880187, PubMed : 27022195, PubMed : 29038465, PubMed : 17803912, PubMed : 15852007). At the plasma membrane, cooperates with LY96 to mediate the innate immune response to bacterial lipopolysaccharide (LPS) (PubMed : 27022195). Also involved in LPS-independent inflammatory responses triggered by free fatty acids, such as palmitate, and Ni(2+) (PubMed : 20711192). Mechanistically, acts via MYD88, TIRAP and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response (PubMed : 10835634, PubMed : 21393102, PubMed : 27022195, PubMed : 36945827, PubMed : 9237759). Alternatively, CD14-mediated TLR4 internalization via endocytosis is associated with the initiation of a MYD88-independent signaling via the TICAM1-TBK1-IRF3 axis leading to type I interferon production (PubMed : 14517278). In addition to the secretion of proinflammatory cytokines, initiates the activation of NLRP3 inflammasome and formation of a positive feedback loop between autophagy and NF-kappa-B signaling cascade (PubMed : 32894580). In complex with TLR6, promotes inflammation in monocytes/macrophages by associating with TLR6 and the receptor CD86 (PubMed : 23880187). Upon ligand binding, such as oxLDL or amyloid-beta 42, the TLR4 : TLR6 complex is internalized and triggers inflammatory response, leading to NF-kappa-B-dependent production of CXCL1, CXCL2 and CCL9 cytokines, via MYD88 signaling pathway, and CCL5 cytokine, via TICAM1 signaling pathway (PubMed : 23880187). In myeloid dendritic cells, vesicular stomatitis virus glycoprotein G but not LPS promotes the activation of IRF7, leading to type I IFN production in a CD14-dependent manner (PubMed : 15265881, PubMed : 23880187). Required for the migration-promoting effects of ZG16B/PAUF on pancreatic cancer cells.

Sequence similarities

Belongs to the Toll-like receptor family.

Post-translational modifications

N-Glycosylation of Asn-526 and Asn-575 by STT3A-containing OST-A complex is necessary for the expression of TLR4 on the cell surface and the LPS-response (PubMed:11706042, PubMed:38670073). Likewise, mutants lacking two or more of the other N-glycosylation sites were deficient in interaction with LPS (PubMed:11706042, PubMed:38670073).. Phosphorylated on tyrosine residues by LYN after binding lipopolysaccharide.. Ubiquitinated by RNF128 via 'Lys-28'-linked polyubiquitin chains, leading to proteasomal degradation.

Product protocols

Target data

Transmembrane receptor that functions as a pattern recognition receptor recognizing pathogen- and damage-associated molecular patterns (PAMPs and DAMPs) to induce innate immune responses via downstream signaling pathways (PubMed : 10835634, PubMed : 15809303, PubMed : 16622205, PubMed : 17292937, PubMed : 17478729, PubMed : 20037584, PubMed : 20711192, PubMed : 23880187, PubMed : 27022195, PubMed : 29038465, PubMed : 17803912, PubMed : 15852007). At the plasma membrane, cooperates with LY96 to mediate the innate immune response to bacterial lipopolysaccharide (LPS) (PubMed : 27022195). Also involved in LPS-independent inflammatory responses triggered by free fatty acids, such as palmitate, and Ni(2+) (PubMed : 20711192). Mechanistically, acts via MYD88, TIRAP and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response (PubMed : 10835634, PubMed : 21393102, PubMed : 27022195, PubMed : 36945827, PubMed : 9237759). Alternatively, CD14-mediated TLR4 internalization via endocytosis is associated with the initiation of a MYD88-independent signaling via the TICAM1-TBK1-IRF3 axis leading to type I interferon production (PubMed : 14517278). In addition to the secretion of proinflammatory cytokines, initiates the activation of NLRP3 inflammasome and formation of a positive feedback loop between autophagy and NF-kappa-B signaling cascade (PubMed : 32894580). In complex with TLR6, promotes inflammation in monocytes/macrophages by associating with TLR6 and the receptor CD86 (PubMed : 23880187). Upon ligand binding, such as oxLDL or amyloid-beta 42, the TLR4 : TLR6 complex is internalized and triggers inflammatory response, leading to NF-kappa-B-dependent production of CXCL1, CXCL2 and CCL9 cytokines, via MYD88 signaling pathway, and CCL5 cytokine, via TICAM1 signaling pathway (PubMed : 23880187). In myeloid dendritic cells, vesicular stomatitis virus glycoprotein G but not LPS promotes the activation of IRF7, leading to type I IFN production in a CD14-dependent manner (PubMed : 15265881, PubMed : 23880187). Required for the migration-promoting effects of ZG16B/PAUF on pancreatic cancer cells.
See full target information TLR4

Publications (5)

Recent publications for all applications. Explore the full list and refine your search

Journal of biomedical science 32:19 PubMed39930418

2025

Multifunctional hyaluronic acid-based biomimetic/pH-responsive hybrid nanostructured lipid carriers for treating bacterial sepsis.

Applications

Unspecified application

Species

Unspecified reactive species

Eman Elhassan,Calvin A Omolo,Mohammed A Gafar,Eman A Ismail,Usri H Ibrahim,Rene Khan,Mathieu Lesouhaitier,Paul Kubes,Thirumala Govender

Cell communication and signaling : CCS 23:64 PubMed39910535

2025

Extracellular vimentin is a damage-associated molecular pattern protein serving as an agonist of TLR4 in human neutrophils.

Applications

Unspecified application

Species

Unspecified reactive species

Łukasz Suprewicz,Krzysztof Fiedoruk,Karol Skłodowski,Evan Hutt,Magdalena Zakrzewska,Alicja Walewska,Piotr Deptuła,Agata Lesiak,Sławomir Okła,Peter A Galie,Alison E Patteson,Paul A Janmey,Robert Bucki

The EMBO journal 43:4954-4983 PubMed39294473

2024

Acetylation of TIR domains in the TLR4-Mal-MyD88 complex regulates immune responses in sepsis.

Applications

Unspecified application

Species

Unspecified reactive species

Xue Li,Xiangrong Li,Pengpeng Huang,Facai Zhang,Juanjuan K Du,Ying Kong,Ziqiang Shao,Xinxing Wu,Weijiao Fan,Houquan Tao,Chuanzan Zhou,Yan Shao,Yanling Jin,Meihua Ye,Yan Chen,Jong Deng,Jimin Shao,Jicheng Yue,Xiaju Cheng,Y Eugene Chinn

Cell reports 41:111562 PubMed36288690

2022

Activation of Toll-like receptor 4 by Ebola virus-shed glycoprotein is direct and requires the internal fusion loop but not glycosylation.

Applications

Unspecified application

Species

Unspecified reactive species

Michael J Scherm,Monique Gangloff,Nicholas J Gay

Frontiers in oncology 11:736882 PubMed34900687

2021

PcrV Enhances the Nitric Oxide-Mediated Tumoricidal Activity of Tumor-Associated Macrophages a TLR4/PI3K/AKT/mTOR-Glycolysis-Nitric Oxide Circuit.

Applications

Unspecified application

Species

Unspecified reactive species

Hua Yu,Ying Bai,Jing Qiu,Xiaomei He,Junzhi Xiong,Qian Dai,Xingmin Wang,Yuanyuan Li,Halei Sheng,Rong Xin,Lu Jiang,Qiaoqiao Li,Defeng Li,Hong Zhang,Le Zhang,Qian Chen,Jin Peng,Xiaomei Hu,Kebin Zhang
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com