JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB162150

Recombinant Human TMEM97 protein (GST tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human TMEM97 protein (GST tag N-Terminus) is a Human Full Length protein, in the 1 to 69 aa range, expressed in Wheat germ, suitable for ELISA, WB.

View Alternative Names

MAC30, S2R, TMEM97, Sigma intracellular receptor 2, Sigma-2 receptor, Sigma2 receptor, Meningioma-associated protein 30, Transmembrane protein 97

1 Images
SDS-PAGE - Recombinant Human TMEM97 protein (GST tag N-Terminus) (AB162150)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human TMEM97 protein (GST tag N-Terminus) (AB162150)

ab162150 on a 12.5% SDS-PAGE stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

ELISA, WB

applications

Biologically active

No

Accession

Q5BJF2

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MTTLIPILSTFLFEDFSKASGFKGQRPETLHERLTLVSVYAPYLLIPFILLIFMLRSPYYKYEEKRKKK","proteinLength":"Full Length","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":69,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"Q5BJF2","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

TMEM97 also known as MAC30 or sigma-2 receptor is a transmembrane protein with a mass of about 23 kDa. This protein is expressed in various tissues with high levels observed in the brain liver and lung. TMEM97 is located in the endoplasmic reticulum and is also present in the plasma membrane suggesting its involvement in multiple cellular processes. Researchers find TMEM97's expression modulated in certain conditions which indicates its potential roles in cellular adaptation and response mechanisms.
Biological function summary

TMEM97 interacts with cholesterol influencing its homeostasis within the cells. It plays a role as a receptor that mediates cholesterol regulation and transport. TMEM97 partners with the low-density lipoprotein receptor (LDLR) family to assist in these functions. It is thought to function in complex with other proteins impacting how cells manage cholesterol levels and their own lipid compositions. This gives TMEM97 a significant position in cellular lipid metabolism.

Pathways

TMEM97 participates in cholesterol biosynthesis and transport pathways. It associates with LXR/RXR signaling which is important for lipid homeostasis and cholesterol metabolism. TMEM97 and its interaction with LDL receptors place it centrally in these pathways influencing how cholesterol is absorbed and processed. TMEM97's involvement suggests a critical role in maintaining lipid balance and supporting healthy cellular functions through these pathways.

TMEM97's connection to cholesterol regulation links it to conditions like Alzheimer's disease and cancer growth. Changes in TMEM97 expression or function may result in altered cholesterol homeostasis which is implicated in neurodegenerative diseases like Alzheimer's. In cancer TMEM97 influences tumor cell growth and survival possibly through its regulation of cholesterol pathways. Its relationship with proteins like the LDL receptor in these contexts shows TMEM97's importance in disease progression and potential as a therapeutic target.

Specifications

Form

Liquid

General info

Function

Sigma-2 receptor which contributes to ameliorate dysfunctional cellular processes and slow degenerative progression by regulating cell functions including cholesterol biosynthesis/trafficking, membrane trafficking, autophagy, lipid membrane-bound protein trafficking, and receptor stabilization at the cell surface (Probable) (PubMed : 19583955, PubMed : 23922215, PubMed : 25620095, PubMed : 27378690, PubMed : 28559337, PubMed : 30443021, PubMed : 34233061, PubMed : 34799735, PubMed : 35970844). Forms a ternary complex with PGRMC1 receptor and low density lipoprotein receptor/LDLR at the plasma membrane, which increases LDLR-mediated LDL cholesterol internalization (PubMed : 30443021). Decreases lysosomal sterol transporter NPC1 availability to the cell, probably through NPC1-binding, hence controlling lipid transport, including cholesterol and LBPA, outside of late endosome/lysosome (PubMed : 19583955, PubMed : 27378690). Binds regio- and stereoselective ligand 20(S)-hydroxycholesterol (20(S)-OHC) which enhances TMEM97-NPC1 interaction and decreases TMEM97-PGRMC1 and TMEM97-TSPO interactions, thereby linking OHC binding to cholesterol homeostasis (PubMed : 34799735, PubMed : 37047353). Also able to bind cholesterol (By similarity). Binds histatin 1 (Hst 1)/HN1 salivary peptide at the ER membrane, which is critical for increasing mitochondria-ER contacts and stimulating Hst1 wound healing properties (PubMed : 34233061, PubMed : 35970844). May alter the activity of some cytochrome P450 proteins (PubMed : 22292588). Although shows homologies with sterol isomerases (EXPERA domain), not able to catalyze sterol isomerization (Probable) (PubMed : 34880501). However, may act as sensors of these molecules (Probable) (PubMed : 34880501). Acts as a quality control factor in the ER, promoting the proteolytic degradation of nonproductive and extramitochondrial precursor proteins in the ER membrane thus removing them from the ER surface (By similarity).

Sequence similarities

Belongs to the TMEM97/sigma-2 receptor family.

Subcellular localisation

Nucleus membrane

Product protocols

Target data

Sigma-2 receptor which contributes to ameliorate dysfunctional cellular processes and slow degenerative progression by regulating cell functions including cholesterol biosynthesis/trafficking, membrane trafficking, autophagy, lipid membrane-bound protein trafficking, and receptor stabilization at the cell surface (Probable) (PubMed : 19583955, PubMed : 23922215, PubMed : 25620095, PubMed : 27378690, PubMed : 28559337, PubMed : 30443021, PubMed : 34233061, PubMed : 34799735, PubMed : 35970844). Forms a ternary complex with PGRMC1 receptor and low density lipoprotein receptor/LDLR at the plasma membrane, which increases LDLR-mediated LDL cholesterol internalization (PubMed : 30443021). Decreases lysosomal sterol transporter NPC1 availability to the cell, probably through NPC1-binding, hence controlling lipid transport, including cholesterol and LBPA, outside of late endosome/lysosome (PubMed : 19583955, PubMed : 27378690). Binds regio- and stereoselective ligand 20(S)-hydroxycholesterol (20(S)-OHC) which enhances TMEM97-NPC1 interaction and decreases TMEM97-PGRMC1 and TMEM97-TSPO interactions, thereby linking OHC binding to cholesterol homeostasis (PubMed : 34799735, PubMed : 37047353). Also able to bind cholesterol (By similarity). Binds histatin 1 (Hst 1)/HN1 salivary peptide at the ER membrane, which is critical for increasing mitochondria-ER contacts and stimulating Hst1 wound healing properties (PubMed : 34233061, PubMed : 35970844). May alter the activity of some cytochrome P450 proteins (PubMed : 22292588). Although shows homologies with sterol isomerases (EXPERA domain), not able to catalyze sterol isomerization (Probable) (PubMed : 34880501). However, may act as sensors of these molecules (Probable) (PubMed : 34880501). Acts as a quality control factor in the ER, promoting the proteolytic degradation of nonproductive and extramitochondrial precursor proteins in the ER membrane thus removing them from the ER surface (By similarity).
See full target information TMEM97

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com