JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB112364

Recombinant Human TMPRSS2 protein

Be the first to review this product! Submit a review

|

(1 Publication)

Recombinant Human TMPRSS2 protein is a Human Fragment protein, in the 383 to 492 aa range, expressed in Wheat germ, with >80%, suitable for SDS-PAGE.

View Alternative Names

PRSS10, TMPRSS2, Transmembrane protease serine 2, Serine protease 10

1 Images
SDS-PAGE - Recombinant Human TMPRSS2 protein (AB112364)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human TMPRSS2 protein (AB112364)

12.5% SDS-PAGE showing ab112364 at approximately 37.73 kDa, stained with Coomassie Blue.

Key facts

Purity

>80%

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

O15393

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"GWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITPAMICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWIYRQMRADG","proteinLength":"Fragment","predictedMolecularWeight":"37.73 kDa","actualMolecularWeight":null,"aminoAcidEnd":492,"aminoAcidStart":383,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"O15393","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Specifications

Form

Liquid

Additional notes

Glutathione Sepharose

General info

Function

Plasma membrane-anchored serine protease that cleaves at arginine residues (PubMed : 32703818, PubMed : 35676539, PubMed : 37990007, PubMed : 38964328). Participates in proteolytic cascades of relevance for the normal physiologic function of the prostate (PubMed : 25122198). Androgen-induced TMPRSS2 activates several substrates that include pro-hepatocyte growth factor/HGF, the protease activated receptor-2/F2RL1 or matriptase/ST14 leading to extracellular matrix disruption and metastasis of prostate cancer cells (PubMed : 15537383, PubMed : 25122198, PubMed : 26018085). In addition, activates trigeminal neurons and contribute to both spontaneous pain and mechanical allodynia (By similarity).. (Microbial infection) Facilitates human coronaviruses SARS-CoV and SARS-CoV-2 infections via two independent mechanisms, proteolytic cleavage of ACE2 receptor which promotes viral uptake, and cleavage of coronavirus spike glycoproteins which activates the glycoprotein for host cell entry (PubMed : 24227843, PubMed : 32142651, PubMed : 32404436, PubMed : 33051876, PubMed : 34159616, PubMed : 35676539, PubMed : 37990007). The cleavage of SARS-COV2 spike glycoprotein occurs between the S2 and S2' site (PubMed : 32703818). Upon SARS-CoV-2 infection, increases syncytia formation by accelerating the fusion process (PubMed : 33051876, PubMed : 34159616, PubMed : 35676539). Proteolytically cleaves and activates the spike glycoproteins of human coronavirus 229E (HCoV-229E) and human coronavirus EMC (HCoV-EMC) and the fusion glycoproteins F0 of Sendai virus (SeV), human metapneumovirus (HMPV), human parainfluenza 1, 2, 3, 4a and 4b viruses (HPIV). Essential for spread and pathogenesis of influenza A virus (strains H1N1, H3N2 and H7N9); involved in proteolytic cleavage and activation of hemagglutinin (HA) protein which is essential for viral infectivity.. (Microbial infection) Receptor for human coronavirus HKU1-CoV, acts synergistically with disialoside glycans to facilitate the entry of the virus. After binding to cell-surface disialoside glycans, the viral S protein interacts with the inactive form of TMPRSS2 and inhibits its protease activity.

Sequence similarities

Belongs to the peptidase S1 family.

Post-translational modifications

Proteolytically processed; by an autocatalytic mechanism. Autocleavage induces active conformation.

Product protocols

Target data

Plasma membrane-anchored serine protease that cleaves at arginine residues (PubMed : 32703818, PubMed : 35676539, PubMed : 37990007, PubMed : 38964328). Participates in proteolytic cascades of relevance for the normal physiologic function of the prostate (PubMed : 25122198). Androgen-induced TMPRSS2 activates several substrates that include pro-hepatocyte growth factor/HGF, the protease activated receptor-2/F2RL1 or matriptase/ST14 leading to extracellular matrix disruption and metastasis of prostate cancer cells (PubMed : 15537383, PubMed : 25122198, PubMed : 26018085). In addition, activates trigeminal neurons and contribute to both spontaneous pain and mechanical allodynia (By similarity).. (Microbial infection) Facilitates human coronaviruses SARS-CoV and SARS-CoV-2 infections via two independent mechanisms, proteolytic cleavage of ACE2 receptor which promotes viral uptake, and cleavage of coronavirus spike glycoproteins which activates the glycoprotein for host cell entry (PubMed : 24227843, PubMed : 32142651, PubMed : 32404436, PubMed : 33051876, PubMed : 34159616, PubMed : 35676539, PubMed : 37990007). The cleavage of SARS-COV2 spike glycoprotein occurs between the S2 and S2' site (PubMed : 32703818). Upon SARS-CoV-2 infection, increases syncytia formation by accelerating the fusion process (PubMed : 33051876, PubMed : 34159616, PubMed : 35676539). Proteolytically cleaves and activates the spike glycoproteins of human coronavirus 229E (HCoV-229E) and human coronavirus EMC (HCoV-EMC) and the fusion glycoproteins F0 of Sendai virus (SeV), human metapneumovirus (HMPV), human parainfluenza 1, 2, 3, 4a and 4b viruses (HPIV). Essential for spread and pathogenesis of influenza A virus (strains H1N1, H3N2 and H7N9); involved in proteolytic cleavage and activation of hemagglutinin (HA) protein which is essential for viral infectivity.. (Microbial infection) Receptor for human coronavirus HKU1-CoV, acts synergistically with disialoside glycans to facilitate the entry of the virus. After binding to cell-surface disialoside glycans, the viral S protein interacts with the inactive form of TMPRSS2 and inhibits its protease activity.
See full target information TMPRSS2

Publications (1)

Recent publications for all applications. Explore the full list and refine your search

Nature communications 13:6375 PubMed36289211

2022

Ultrafast one-minute electronic detection of SARS-CoV-2 infection by 3CL enzymatic activity in untreated saliva samples.

Applications

Unspecified application

Species

Unspecified reactive species

Ella Borberg,Eran Granot,Fernando Patolsky
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com