JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB131786

Recombinant Human TMS1/ASC protein (Tag Free)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human TMS1/ASC protein (Tag Free) is a Human Fragment protein, in the 47 to 195 aa range, expressed in Wheat germ, suitable for SDS-PAGE, ELISA, WB.

View Alternative Names

ASC, CARD5, TMS1, PYCARD, Apoptosis-associated speck-like protein containing a CARD, hASC, Caspase recruitment domain-containing protein 5, PYD and CARD domain-containing protein, Target of methylation-induced silencing 1

1 Images
SDS-PAGE - Recombinant Human TMS1/ASC protein (Tag Free) (AB131786)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human TMS1/ASC protein (Tag Free) (AB131786)

12.5% SDS-PAGE analysis of ab131786 stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

Tag free

Applications

ELISA, SDS-PAGE, WB

applications

Biologically active

No

Accession

Q9ULZ3

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

Protein concentration is above or equal to 0.05 ug/ul. This product was previously labelled as TMS1

Sequence info

[{"sequence":"MDALDLTDKLVSFYLETYGAELTANVLRDMGLQEMAGQLQAATHQGSGAAPAGIQAPPQSAAKPGLHFIDQHRAALIARVTNVEWLLDALYGKVLTDEQYQAVRAEPTNPSKMRKLFNFTPAWNWTCKDLLLQALRESQSYLVEDLERS","proteinLength":"Fragment","predictedMolecularWeight":"42.13 kDa","actualMolecularWeight":null,"aminoAcidEnd":195,"aminoAcidStart":47,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"Q9ULZ3","tags":[]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Specifications

Form

Liquid

General info

Function

Functions as a key mediator in apoptosis and inflammation (PubMed : 11103777, PubMed : 12646168, PubMed : 15030775, PubMed : 17349957, PubMed : 17599095, PubMed : 19158675, PubMed : 19158676, PubMed : 19234215, PubMed : 19494289, PubMed : 21487011, PubMed : 24630722, PubMed : 25847972, PubMed : 30674671, PubMed : 34678144, PubMed : 36050480). Promotes caspase-mediated apoptosis involving predominantly caspase-8 and also caspase-9 in a probable cell type-specific manner (PubMed : 11103777, PubMed : 12646168). Involved in activation of the mitochondrial apoptotic pathway, promotes caspase-8-dependent proteolytic maturation of BID independently of FADD in certain cell types and also mediates mitochondrial translocation of BAX and activates BAX-dependent apoptosis coupled to activation of caspase-9, -2 and -3 (PubMed : 14730312, PubMed : 16964285). Involved in innate immune response by acting as an integral adapter in the assembly of various inflammasomes (NLRP1, NLRP2, NLRP3, NLRP6, AIM2 and probably IFI16) which recruit and activate caspase-1 leading to processing and secretion of pro-inflammatory cytokines (PubMed : 15030775, PubMed : 16982856, PubMed : 17349957, PubMed : 17599095, PubMed : 19158675, PubMed : 19158676, PubMed : 19234215, PubMed : 21487011, PubMed : 23530044, PubMed : 24630722, PubMed : 25847972, PubMed : 29440442, PubMed : 30674671, PubMed : 33980849, PubMed : 34678144, PubMed : 34706239). Caspase-1-dependent inflammation leads to macrophage pyroptosis, a form of cell death (PubMed : 24630722). The function as activating adapter in different types of inflammasomes is mediated by the pyrin and CARD domains and their homotypic interactions (PubMed : 14499617, PubMed : 19234215, PubMed : 24630722). Clustered PYCARD nucleates the formation of caspase-1 filaments through the interaction of their respective CARD domains, acting as a platform for of caspase-1 polymerization (PubMed : 24630722). In the NLRP1 and NLRC4 inflammasomes seems not be required but facilitates the processing of procaspase-1 (PubMed : 17349957). In cooperation with NOD2 involved in an inflammasome activated by bacterial muramyl dipeptide leading to caspase-1 activation (PubMed : 16964285). May be involved in RIGI-triggered pro-inflammatory responses and inflammasome activation (PubMed : 19915568). In collaboration with AIM2 which detects cytosolic double-stranded DNA may also be involved in a caspase-1-independent cell death that involves caspase-8 (PubMed : 19158675, PubMed : 19158676). In adaptive immunity may be involved in maturation of dendritic cells to stimulate T-cell immunity and in cytoskeletal rearrangements coupled to chemotaxis and antigen uptake may be involved in post-transcriptional regulation of the guanine nucleotide exchange factor DOCK2; the latter function is proposed to involve the nuclear form (PubMed : 22732093). Also involved in transcriptional activation of cytokines and chemokines independent of the inflammasome; this function may involve AP-1, NF-kappa-B, MAPK and caspase-8 signaling pathways (PubMed : 12486103, PubMed : 16585594). For regulation of NF-kappa-B activating and inhibiting functions have been reported (PubMed : 12486103). Modulates NF-kappa-B induction at the level of the IKK complex by inhibiting kinase activity of CHUK and IKBK (PubMed : 12486103, PubMed : 16585594). Proposed to compete with RIPK2 for association with CASP1 thereby down-regulating CASP1-mediated RIPK2-dependent NF-kappa-B activation and activating interleukin-1 beta processing (PubMed : 16585594). Modulates host resistance to DNA virus infection, probably by inducing the cleavage of and inactivating CGAS in presence of cytoplasmic double-stranded DNA (PubMed : 28314590).. Isoform 2. May have a regulating effect on the function as inflammasome adapter.. Isoform 3. Seems to inhibit inflammasome-mediated maturation of interleukin-1 beta.

Post-translational modifications

Phosphorylated.. 'Lys-63'-linked polyubiquitination by TRAF3 is critical for speck formation and inflammasome activation (PubMed:25847972). 'Lys-63'-linked deubiquitinated by USP50; a crucial step for NLRP3-mediated inflammasome activation (PubMed:28094437). 'Lys-63'-linked polyubiquitination by PELI1 is also critical for speck formation and inflammasome activation (PubMed:34706239). Deubiquitinated by USP3 that cleaves 'Lys-48'-linked ubiquitin chains and strengthens its stability by blocking proteasomal degradation (PubMed:36050480).

Product protocols

Target data

Functions as a key mediator in apoptosis and inflammation (PubMed : 11103777, PubMed : 12646168, PubMed : 15030775, PubMed : 17349957, PubMed : 17599095, PubMed : 19158675, PubMed : 19158676, PubMed : 19234215, PubMed : 19494289, PubMed : 21487011, PubMed : 24630722, PubMed : 25847972, PubMed : 30674671, PubMed : 34678144, PubMed : 36050480). Promotes caspase-mediated apoptosis involving predominantly caspase-8 and also caspase-9 in a probable cell type-specific manner (PubMed : 11103777, PubMed : 12646168). Involved in activation of the mitochondrial apoptotic pathway, promotes caspase-8-dependent proteolytic maturation of BID independently of FADD in certain cell types and also mediates mitochondrial translocation of BAX and activates BAX-dependent apoptosis coupled to activation of caspase-9, -2 and -3 (PubMed : 14730312, PubMed : 16964285). Involved in innate immune response by acting as an integral adapter in the assembly of various inflammasomes (NLRP1, NLRP2, NLRP3, NLRP6, AIM2 and probably IFI16) which recruit and activate caspase-1 leading to processing and secretion of pro-inflammatory cytokines (PubMed : 15030775, PubMed : 16982856, PubMed : 17349957, PubMed : 17599095, PubMed : 19158675, PubMed : 19158676, PubMed : 19234215, PubMed : 21487011, PubMed : 23530044, PubMed : 24630722, PubMed : 25847972, PubMed : 29440442, PubMed : 30674671, PubMed : 33980849, PubMed : 34678144, PubMed : 34706239). Caspase-1-dependent inflammation leads to macrophage pyroptosis, a form of cell death (PubMed : 24630722). The function as activating adapter in different types of inflammasomes is mediated by the pyrin and CARD domains and their homotypic interactions (PubMed : 14499617, PubMed : 19234215, PubMed : 24630722). Clustered PYCARD nucleates the formation of caspase-1 filaments through the interaction of their respective CARD domains, acting as a platform for of caspase-1 polymerization (PubMed : 24630722). In the NLRP1 and NLRC4 inflammasomes seems not be required but facilitates the processing of procaspase-1 (PubMed : 17349957). In cooperation with NOD2 involved in an inflammasome activated by bacterial muramyl dipeptide leading to caspase-1 activation (PubMed : 16964285). May be involved in RIGI-triggered pro-inflammatory responses and inflammasome activation (PubMed : 19915568). In collaboration with AIM2 which detects cytosolic double-stranded DNA may also be involved in a caspase-1-independent cell death that involves caspase-8 (PubMed : 19158675, PubMed : 19158676). In adaptive immunity may be involved in maturation of dendritic cells to stimulate T-cell immunity and in cytoskeletal rearrangements coupled to chemotaxis and antigen uptake may be involved in post-transcriptional regulation of the guanine nucleotide exchange factor DOCK2; the latter function is proposed to involve the nuclear form (PubMed : 22732093). Also involved in transcriptional activation of cytokines and chemokines independent of the inflammasome; this function may involve AP-1, NF-kappa-B, MAPK and caspase-8 signaling pathways (PubMed : 12486103, PubMed : 16585594). For regulation of NF-kappa-B activating and inhibiting functions have been reported (PubMed : 12486103). Modulates NF-kappa-B induction at the level of the IKK complex by inhibiting kinase activity of CHUK and IKBK (PubMed : 12486103, PubMed : 16585594). Proposed to compete with RIPK2 for association with CASP1 thereby down-regulating CASP1-mediated RIPK2-dependent NF-kappa-B activation and activating interleukin-1 beta processing (PubMed : 16585594). Modulates host resistance to DNA virus infection, probably by inducing the cleavage of and inactivating CGAS in presence of cytoplasmic double-stranded DNA (PubMed : 28314590).. Isoform 2. May have a regulating effect on the function as inflammasome adapter.. Isoform 3. Seems to inhibit inflammasome-mediated maturation of interleukin-1 beta.
See full target information PYCARD

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com