JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB159687

Recombinant Human Transferrin Receptor protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human Transferrin Receptor protein is a Human Fragment protein, in the 68 to 168 aa range, expressed in Wheat germ, suitable for ELISA, WB.

View Alternative Names

CD71, Transferrin receptor protein 1, TR, TfR, TfR1, Trfr, T9, p90, TFRC

1 Images
SDS-PAGE - Recombinant Human Transferrin Receptor protein (AB159687)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human Transferrin Receptor protein (AB159687)

ab159687 on a 12.5% SDS-PAGE stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

ELISA, WB

applications

Biologically active

No

Accession

P02786

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"YGTIAVIVFFLIGFMIGYLGYCKGVEPKTECERLAGTESPVREEPGEDFPAARRLYWDDLKRKLSEKLDSTDFTGTIKLLNENSYVPREAGSQKDENLALY","proteinLength":"Fragment","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":168,"aminoAcidStart":68,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"P02786","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The transferrin receptor commonly referred to as TfR or CD71 is an integral membrane protein that facilitates the uptake of transferrin-bound iron into cells. This receptor has a molecular weight of around 95 kDa and often exists as a homodimer on the cell surface. It is widely expressed in many tissues especially in erythroid precursors and rapidly dividing cells. Alternate names for this receptor include TfR1 and TfR2 though they have distinct roles and distributions. Other transmembrane proteins like OX26 and MEM have been studied in relation to the transferrin receptor due to their involvement in drug delivery.
Biological function summary

TfR plays a critical role in iron homeostasis by mediating the internalization of transferrin and release of iron in the endosomes. It operates as part of the transferrin-transferrin receptor complex facilitating iron assimilation necessary for DNA synthesis and cell growth. Iron release involves acidifying endosomes allowing transferrin to bind with specific cellular receptors including alternate forms like beta 2 transferrin. The process subsequently contributes to erythropoiesis and various metabolic processes by regulating essential cellular iron levels.

Pathways

The transferrin receptor is central to iron metabolism and the receptor-mediated endocytosis pathway. It tightly interacts with transferrin and intracellular pathways process the iron released from transferrin within endosomes. The receptor's role in this pathway involves a dynamic with other proteins such as HFE and hepcidin. These interactions help control systemic iron levels linking closely to the maintenance of erythroid cell health and proliferation.

Disruptions in transferrin receptor function correlate with anemia and neurodegenerative disorders. In anemia related to iron deficiency impaired TfR activity reduces iron uptake culminating in insufficient erythropoiesis. Altered receptor expression or function also connects to neurological diseases like Alzheimer's where iron dysregulation is a concern. Here the transferrin receptor interacts with proteins like Amyloid precursor protein contributing to disease pathology through improper metal homeostasis.

Specifications

Form

Liquid

General info

Function

The protein expressed by the gene TFRC is involved in the cellular uptake of iron via receptor-mediated endocytosis, where the transferrin receptor, bound to its ligand, is internalized into specialized endosomes. Following endosomal acidification, iron is released, and the apotransferrin-receptor complex is recycled to the cell surface, where a return to neutral pH results in the loss of apotransferrin's affinity for its receptor. The hereditary hemochromatosis protein HFE competes with transferrin for binding at an overlapping C-terminal site. TFRC positively regulates T and B cell proliferation through iron uptake. It functions as a lipid sensor influencing mitochondrial fusion by modulating the JNK pathway activity. Low dietary levels of stearate promote JNK pathway activation, leading to HUWE1-mediated ubiquitination and degradation of the mitofusin MFN2, inhibiting mitochondrial fusion. High dietary stearate levels result in TFRC stearoylation, which inhibits JNK pathway activation and MFN2 degradation. Additionally, TFRC acts as a receptor for new-world arenaviruses, including Guanarito, Junin, and Machupo viruses. This supplementary information is collated from multiple sources and compiled automatically.

Sequence similarities

Belongs to the peptidase M28 family. M28B subfamily.

Post-translational modifications

Stearoylated by ZDHHC6 which inhibits TFRC-mediated activation of the JNK pathway and promotes mitochondrial fragmentation (PubMed:26214738). Stearoylation does not affect iron uptake (PubMed:26214738).. N- and O-glycosylated, phosphorylated and palmitoylated. The serum form is only glycosylated.. Proteolytically cleaved on Arg-100 to produce the soluble serum form (sTfR).. Palmitoylated on both Cys-62 and Cys-67. Cys-62 seems to be the major site of palmitoylation.

Product protocols

Target data

The protein expressed by the gene TFRC is involved in the cellular uptake of iron via receptor-mediated endocytosis, where the transferrin receptor, bound to its ligand, is internalized into specialized endosomes. Following endosomal acidification, iron is released, and the apotransferrin-receptor complex is recycled to the cell surface, where a return to neutral pH results in the loss of apotransferrin's affinity for its receptor. The hereditary hemochromatosis protein HFE competes with transferrin for binding at an overlapping C-terminal site. TFRC positively regulates T and B cell proliferation through iron uptake. It functions as a lipid sensor influencing mitochondrial fusion by modulating the JNK pathway activity. Low dietary levels of stearate promote JNK pathway activation, leading to HUWE1-mediated ubiquitination and degradation of the mitofusin MFN2, inhibiting mitochondrial fusion. High dietary stearate levels result in TFRC stearoylation, which inhibits JNK pathway activation and MFN2 degradation. Additionally, TFRC acts as a receptor for new-world arenaviruses, including Guanarito, Junin, and Machupo viruses. This supplementary information is collated from multiple sources and compiled automatically.
See full target information TFRC

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com