JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB163206

Recombinant Human Transmembrane protein 30A (GST tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human Transmembrane protein 30A (GST tag N-Terminus) is a Human Full Length protein, in the 1 to 361 aa range, expressed in Wheat germ, suitable for ELISA, WB.

View Alternative Names

C6orf67, CDC50A, TMEM30A, Cell cycle control protein 50A, P4-ATPase flippase complex beta subunit TMEM30A, Transmembrane protein 30A

1 Images
SDS-PAGE - Recombinant Human Transmembrane protein 30A (GST tag N-Terminus) (AB163206)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human Transmembrane protein 30A (GST tag N-Terminus) (AB163206)

ab163206 on a 12.5% SDS-PAGE stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

ELISA, WB

applications

Biologically active

No

Accession

Q9NV96

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MAMNYNAKDEVDGGPPCAPGGTAKTRRPDNTAFKQQRLPAWQPILTAGTVLPIFFIIGLIFIPIGIGIFVTSNNIREIEIDYTGTEPSSPCNKCLSPDVTPCFCTINFTLEKSFEGNVFMYYGLSNFYQNHRRYVKSRDDSQLNGDSSALLNPSKECEPYRRNEDKPIAPCGAIANSMFNDTLELFLIGNDSYPIPIALKKKGIAWWTDKNVKFRNPPGGDNLEERFKGTTKPVNWLKPVYMLDSDPDNNGFINEDFIVWMRTAALPTFRKLYRLIERKSDLHPTLPAGRYSLNVTYNYPVHYFDGRKRMILSTISWMGGKNPFLGIAYIAVGSISFLLGVVLLVINHKYRNSSNTADITI","proteinLength":"Full Length","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":361,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"Q9NV96","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Transmembrane protein 30A also known as TMEM30A has an important role in cellular function as a component of the cell membrane. It is a 31 kDa protein that facilitates the transportation of certain lipids from the outer to the inner leaflets of the plasma membrane functioning as a chaperone alongside other transporters. TMEM30A shows expression in various tissues with notable levels in the brain heart and kidney reflecting its diverse cellular roles in different organ systems.
Biological function summary

TMEM30A is critical in maintaining lipid asymmetry in cell membranes. It acts within a larger complex with flippases such as ATP11 and ATP8 proteins enabling the efficient translocation of phospholipids. This activity affects membrane curvature and flexibility which is essential for cellular processes like vesicle formation endocytosis and maintenance of membrane integrity. Disruption in TMEM30A function can result in altered cellular homeostasis impacting cell viability and signaling.

Pathways

TMEM30A plays a significant part in the phospholipid flipping pathway chiefly interacting with ATP11C in energizing the lipid translocation process. This pathway is fundamental for activities like signal transduction and apoptosis where these lipids serve as substrates or signaling molecules. The protein also interrelates with the calcium signaling pathway wherein altered phospholipid distribution can influence calcium ion channels therefore impacting cellular responses and homeostasis.

TMEM30A has associations with neurological disorders and cardiovascular diseases. Disturbances in its function link closely with Alzheimer's disease where phosphatidylserine asymmetry is compromised affecting neuronal communication. TMEM30A is also relevant in the context of heart failure interacting with proteins like ATP8A1 where improper lipid transport can impair cardiac function. Dysregulation of these pathways due to TMEM30A mutations highlights its importance in maintaining physiological health.

Specifications

Form

Liquid

General info

Function

Accessory component of a P4-ATPase flippase complex which catalyzes the hydrolysis of ATP coupled to the transport of aminophospholipids from the outer to the inner leaflet of various membranes and ensures the maintenance of asymmetric distribution of phospholipids. Phospholipid translocation seems also to be implicated in vesicle formation and in uptake of lipid signaling molecules. The beta subunit may assist in binding of the phospholipid substrate. Required for the proper folding, assembly and ER to Golgi exit of the ATP8A2 : TMEM30A flippase complex. ATP8A2 : TMEM30A may be involved in regulation of neurite outgrowth, and, reconstituted to liposomes, predomiminantly transports phosphatidylserine (PS) and to a lesser extent phosphatidylethanolamine (PE). The ATP8A1 : TMEM30A flippase complex seems to play a role in regulation of cell migration probably involving flippase-mediated translocation of phosphatidylethanolamine (PE) at the plasma membrane. Required for the formation of the ATP8A2, ATP8B1 and ATP8B2 P-type ATPAse intermediate phosphoenzymes. Involved in uptake of platelet-activating factor (PAF), synthetic drug alkylphospholipid edelfosine, and, probably in association with ATP8B1, of perifosine. Also mediates the export of alpha subunits ATP8A1, ATP8B1, ATP8B2, ATP8B4, ATP10A, ATP10B, ATP10D, ATP11A, ATP11B and ATP11C from the ER to other membrane localizations.

Sequence similarities

Belongs to the CDC50/LEM3 family.

Post-translational modifications

N-glycosylated. Contains high mannose-type oligosaccharides (By similarity).

Product protocols

Target data

Accessory component of a P4-ATPase flippase complex which catalyzes the hydrolysis of ATP coupled to the transport of aminophospholipids from the outer to the inner leaflet of various membranes and ensures the maintenance of asymmetric distribution of phospholipids. Phospholipid translocation seems also to be implicated in vesicle formation and in uptake of lipid signaling molecules. The beta subunit may assist in binding of the phospholipid substrate. Required for the proper folding, assembly and ER to Golgi exit of the ATP8A2 : TMEM30A flippase complex. ATP8A2 : TMEM30A may be involved in regulation of neurite outgrowth, and, reconstituted to liposomes, predomiminantly transports phosphatidylserine (PS) and to a lesser extent phosphatidylethanolamine (PE). The ATP8A1 : TMEM30A flippase complex seems to play a role in regulation of cell migration probably involving flippase-mediated translocation of phosphatidylethanolamine (PE) at the plasma membrane. Required for the formation of the ATP8A2, ATP8B1 and ATP8B2 P-type ATPAse intermediate phosphoenzymes. Involved in uptake of platelet-activating factor (PAF), synthetic drug alkylphospholipid edelfosine, and, probably in association with ATP8B1, of perifosine. Also mediates the export of alpha subunits ATP8A1, ATP8B1, ATP8B2, ATP8B4, ATP10A, ATP10B, ATP10D, ATP11A, ATP11B and ATP11C from the ER to other membrane localizations.
See full target information TMEM30A

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com