JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB114514

Recombinant Human Transportin 1/MIP protein (GST tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human Transportin 1/MIP protein (GST tag N-Terminus) is a Human Fragment protein, in the 25 to 141 aa range, expressed in Wheat germ, suitable for SDS-PAGE, ELISA, WB.

View Alternative Names

KPNB2, MIP1, TRN, TNPO1, Transportin-1, Importin beta-2, Karyopherin beta-2, M9 region interaction protein, MIP

1 Images
SDS-PAGE - Recombinant Human Transportin 1/MIP protein (GST tag N-Terminus) (AB114514)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human Transportin 1/MIP protein (GST tag N-Terminus) (AB114514)

ab114514 analysed by 12.5% SDS-PAGE and stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

SDS-PAGE, ELISA, WB

applications

Biologically active

No

Accession

Q92973

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.3% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

This product was previously labelled as Transportin 1.

Sequence info

[{"sequence":"PDTTIQRTVQQKLEQLNQYPDFNNYLIFVLTKLKSEDEPTRSLSGLILKNNVKAHFQNFPNGVTDFIKSECLNNIGDSSPLIRATVGILITTIASKGELQNWPDLLPKLCSLLDSED","proteinLength":"Fragment","predictedMolecularWeight":"38.5 kDa","actualMolecularWeight":null,"aminoAcidEnd":141,"aminoAcidStart":25,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"Q92973","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Transportin 1 also known as MIP-1 TRN1 or TNPO1 is a protein involved in nuclear transport mechanisms. It functions as a part of the importin-beta family facilitating the transport of cargo proteins into the nucleus by recognizing nuclear localization signals (NLS). Transportin 1 has a molecular weight of approximately 98 kDa and is expressed widely in various tissues. This protein is essential for the nucleocytoplasmic transport operating predominantly in the cytoplasm where it interacts with its cargoes.
Biological function summary

Transportin 1 is an important component in cellular operation by being part of the nuclear pore complex. It mediates the translocation of proteins across the nuclear envelope. The protein plays a role in not just import but also export of numerous cellular regulators and factors influencing gene expression and cell cycle progression. Being part of such complexes places it at the core of many fundamental cellular processes.

Pathways

The actions of Transportin 1 are integral to nuclear-cytoplasmic transport pathways and the Ran-GTPase pathway. It interacts with the small GTPase Ran which provides the necessary energy for active transport and directionality across the nuclear pore complexes. Additionally Transportin 1 shows functional similarity with importin-alpha which expands its role to include overlap in pathway regulation and cargo specificity further embedding it in complex cellular signaling networks.

Transportin 1 has been linked to neurodegenerative conditions and certain cancers. Its role in improper protein transport potentially contributes to the pathogenesis of neurodegenerative diseases like amyotrophic lateral sclerosis (ALS) where mislocalized proteins accumulate improperly. Transportin 1 also associates with the protein TDP-43 known to play a role in ALS and other similar disorders. In cancer abnormal expression of Transportin 1 can alter nuclear transport dynamics affecting tumor suppressor and oncogene distribution thereby contributing to tumorigenesis and cancer progression.

Specifications

Form

Liquid

General info

Function

Functions in nuclear protein import as nuclear transport receptor. Serves as receptor for nuclear localization signals (NLS) in cargo substrates (PubMed : 24753571). May mediate docking of the importin/substrate complex to the nuclear pore complex (NPC) through binding to nucleoporin and the complex is subsequently translocated through the pore by an energy requiring, Ran-dependent mechanism. At the nucleoplasmic side of the NPC, Ran binds to the importin, the importin/substrate complex dissociates and importin is re-exported from the nucleus to the cytoplasm where GTP hydrolysis releases Ran. The directionality of nuclear import is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus (By similarity). Involved in nuclear import of M9-containing proteins. In vitro, binds directly to the M9 region of the heterogeneous nuclear ribonucleoproteins (hnRNP), A1 and A2 and mediates their nuclear import. Involved in hnRNP A1/A2 nuclear export. Mediates the nuclear import of ribosomal proteins RPL23A, RPS7 and RPL5 (PubMed : 11682607). In vitro, mediates nuclear import of H2A, H2B, H3 and H4 histones (By similarity). In vitro, mediates nuclear import of SRP19 (PubMed : 11682607). Mediates nuclear import of ADAR/ADAR1 isoform 1 and isoform 5 in a RanGTP-dependent manner (PubMed : 19124606, PubMed : 24753571). Main mediator of PR-DUB complex component BAP1 nuclear import; acts redundantly with the karyopherins KPNA1 and KPNA2 (PubMed : 35446349).. (Microbial infection) In case of HIV-1 infection, binds and mediates the nuclear import of HIV-1 Rev.

Sequence similarities

Belongs to the importin beta family. Importin beta-2 subfamily.

Subcellular localisation

Nucleus

Product protocols

Target data

Functions in nuclear protein import as nuclear transport receptor. Serves as receptor for nuclear localization signals (NLS) in cargo substrates (PubMed : 24753571). May mediate docking of the importin/substrate complex to the nuclear pore complex (NPC) through binding to nucleoporin and the complex is subsequently translocated through the pore by an energy requiring, Ran-dependent mechanism. At the nucleoplasmic side of the NPC, Ran binds to the importin, the importin/substrate complex dissociates and importin is re-exported from the nucleus to the cytoplasm where GTP hydrolysis releases Ran. The directionality of nuclear import is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus (By similarity). Involved in nuclear import of M9-containing proteins. In vitro, binds directly to the M9 region of the heterogeneous nuclear ribonucleoproteins (hnRNP), A1 and A2 and mediates their nuclear import. Involved in hnRNP A1/A2 nuclear export. Mediates the nuclear import of ribosomal proteins RPL23A, RPS7 and RPL5 (PubMed : 11682607). In vitro, mediates nuclear import of H2A, H2B, H3 and H4 histones (By similarity). In vitro, mediates nuclear import of SRP19 (PubMed : 11682607). Mediates nuclear import of ADAR/ADAR1 isoform 1 and isoform 5 in a RanGTP-dependent manner (PubMed : 19124606, PubMed : 24753571). Main mediator of PR-DUB complex component BAP1 nuclear import; acts redundantly with the karyopherins KPNA1 and KPNA2 (PubMed : 35446349).. (Microbial infection) In case of HIV-1 infection, binds and mediates the nuclear import of HIV-1 Rev.
See full target information TNPO1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com