JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB159163

Recombinant Human TRAP220/MED1 protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human TRAP220/MED1 protein is a Human Fragment protein, in the 1391 to 1490 aa range, expressed in Wheat germ, suitable for ELISA, WB.

View Alternative Names

ARC205, CRSP1, CRSP200, DRIP205, DRIP230, PBP, PPARBP, PPARGBP, RB18A, TRAP220, TRIP2, MED1, Mediator of RNA polymerase II transcription subunit 1, Activator-recruited cofactor 205 kDa component, Mediator complex subunit 1, Peroxisome proliferator-activated receptor-binding protein, Thyroid hormone receptor-associated protein complex 220 kDa component, Thyroid receptor-interacting protein 2, Vitamin D receptor-interacting protein complex component DRIP205, p53 regulatory protein RB18A, PPAR-binding protein, Trap220, TR-interacting protein 2, TRIP-2

1 Images
SDS-PAGE - Recombinant Human TRAP220/MED1 protein (AB159163)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human TRAP220/MED1 protein (AB159163)

ab159163 on a 12.5% SDS-PAGE stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

WB, ELISA

applications

Biologically active

No

Accession

Q15648

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"KIIISKHDGGSPSIKAKVTLQKPGESSGEGLRPQMASSKNYGSPLISGSTPKHERGSPSHSKSPAYTPQNLDSESESGSSIAEKSYQNSPSSDDGIRPLP","proteinLength":"Fragment","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":1490,"aminoAcidStart":1391,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"Q15648","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

TRAP220 also known as MED1 is a protein with a molecular mass of approximately 220 kDa. It plays an important role as a component of the mediator complex which is important for transcription regulation. The expression of TRAP220/MED1 is found in various tissues with higher levels observed in liver lung and heart tissues. This protein acts mechanistically as a bridge between gene-specific transcription factors and RNA polymerase II facilitating the assembly of the pre-initiation complex.
Biological function summary

TRAP220/MED1 functions within the larger mediator complex a multi-protein coactivator essential for gene transcription by RNA polymerase II. It plays an important role in nuclear receptor signaling facilitating the transcriptional activation by various nuclear hormone receptors. MED1 interacts directly with these receptors through its various domains allowing the transcription of target genes responsive to hormonal signals.

Pathways

TRAP220/MED1 contributes significantly to transcriptional activation pathways involving nuclear receptors such as the PPAR (Peroxisome Proliferator-Activated Receptor) and thyroid hormone receptor pathways. It closely interacts with other proteins in these pathways including MED12 and MED14 which form integral parts of the mediator complex's function. Its involvement in these pathways highlights its critical role in lipid metabolism and energy homeostasis.

TRAP220/MED1 is associated with metabolic and proliferative diseases. Its altered expression or mutations can lead to conditions such as obesity and cancer. For instance aberrant MED1 activity or expression levels have connections to breast cancer development through its role in estrogen receptor-mediated gene expression. This correlation emphasizes the protein's potential impact in various pathophysiological contexts driving ongoing research into MED1 as a therapeutic target.

Specifications

Form

Liquid

General info

Function

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (PubMed : 10406464, PubMed : 11867769, PubMed : 12037571, PubMed : 12218053, PubMed : 12556447, PubMed : 14636573, PubMed : 15340084, PubMed : 15471764, PubMed : 15989967, PubMed : 16574658, PubMed : 9653119). Acts as a coactivator for GATA1-mediated transcriptional activation during erythroid differentiation of K562 erythroleukemia cells (PubMed : 24245781).

Sequence similarities

Belongs to the Mediator complex subunit 1 family.

Post-translational modifications

Phosphorylated by MAPK1 or MAPK3 during G2/M phase which may enhance protein stability and promote entry into the nucleolus (PubMed:16314496). Phosphorylation increases its interaction with PSIP1 (PubMed:29997176).

Subcellular localisation

Nucleus

Product protocols

Target data

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (PubMed : 10406464, PubMed : 11867769, PubMed : 12037571, PubMed : 12218053, PubMed : 12556447, PubMed : 14636573, PubMed : 15340084, PubMed : 15471764, PubMed : 15989967, PubMed : 16574658, PubMed : 9653119). Acts as a coactivator for GATA1-mediated transcriptional activation during erythroid differentiation of K562 erythroleukemia cells (PubMed : 24245781).
See full target information MED1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com