JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB151651

Recombinant Human TREM1 protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human TREM1 protein is a Human Fragment protein, in the 21 to 200 aa range, expressed in HEK 293 cells, with >95%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE, HPLC.

View Alternative Names

CD354, Triggering receptor expressed on myeloid cells 1, TREM-1, Triggering receptor expressed on monocytes 1, TREM1

Key facts

Purity

>95% SDS-PAGE

Endotoxin level

< 1 EU/µg

Expression system

HEK 293 cells

Tags

His tag C-Terminus

Applications

HPLC, SDS-PAGE

applications

Biologically active

No

Accession

Q9NP99

Animal free

No

Carrier free

No

Species

Human

Reconstitution

Reconstitute in PBS

Storage buffer

pH: 7.2 Constituents: 99% Phosphate Buffer, 0.88% Sodium chloride

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "HPLC": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"ATKLTEEKYELKEGQTLDVKCDYTLEKFASSQKAWQIIRDGEMPKTLACTERPSKNSHPVQVGRIILEDYHDHGLLRVRMVNLQVEDSGLYQCVIYQPPKEPHMLFDRIRLVVTKGFSGTPGSNENSTQNVYKIPPTTTKALCPLYTSPRTVTQAPPKSTADVSTPDSEINLTNVTDIIRVDHHHHHH","proteinLength":"Fragment","predictedMolecularWeight":"20.4 kDa","actualMolecularWeight":null,"aminoAcidEnd":200,"aminoAcidStart":21,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"Q9NP99","tags":[{"tag":"His","terminus":"C-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Triggering receptor expressed on myeloid cells 1 (TREM1) is a transmembrane receptor involved in amplifying inflammatory responses. TREM1 is known alternatively as CD354. This protein has a molecular mass of approximately 30 kDa and is expressed on the surface of neutrophils monocytes and macrophages. The receptor participates in innate immune responses and acts as an amplifier for inflammatory signals. It is often found in tissues that are engaged in inflammatory processes including lungs and intestines.
Biological function summary

TREM1 significantly enhances the immune response by activating myeloid cells. It does not form a standalone unit; instead it works with the adapter protein DNAX-activating protein of 12 kDa (DAP12) which pairs with TREM1 to transduce signals that promote cytokine and chemokine release. Through this interaction the receptor plays a role in the defense against bacterial infection boosting the body's immune response during pathogen assault. This function positions TREM1 as an important player in the regulation of acute inflammation.

Pathways

TREM1 engages significantly in the Toll-like receptor (TLR) signaling pathway and NF-kB pathway. In these pathways TREM1 interacts with various proteins that include TLRs and DAP12 intensifying inflammatory responses. The integration of TREM1 within these pathways suggests that it acts as an important modulator of inflammation capable of enhancing TLR-mediated signals for a stronger immune response.

TREM1 connections extend to sepsis and inflammatory bowel disease (IBD). In the context of sepsis TREM1 expression correlates with increased inflammation and poor prognosis where it interacts with proteins involved in inflammatory pathways such as TNF-α. Concerning IBD TREM1's role in promoting inflammation links it to the pathogenesis of this disease where it could influence the severity and progression of IBD-related inflammation. Given these relationships therapeutic strategies targeting TREM1 could hold potential in modulating these conditions.

Specifications

Form

Lyophilized

Additional notes

ab151651 was determined to be >95% pure by SEC-HPLC and reducing SDS-PAGE.

General info

Function

Isoform 1. Cell surface receptor that plays important roles in innate and adaptive immunity by amplifying inflammatory responses (PubMed : 10799849, PubMed : 21393102). Upon activation by various ligands such as PGLYRP1, HMGB1 or HSP70, multimerizes and forms a complex with transmembrane adapter TYROBP/DAP12 (PubMed : 17568691, PubMed : 25595774, PubMed : 29568119). In turn, initiates a SYK-mediated cascade of tyrosine phosphorylation, activating multiple downstream mediators such as BTK, MAPK1, MAPK3 or phospholipase C-gamma (PubMed : 14656437, PubMed : 21659545). This cascade promotes the neutrophil- and macrophage-mediated release of pro-inflammatory cytokines and/or chemokines, as well as their migration and thereby amplifies inflammatory responses that are triggered by bacterial and fungal infections (PubMed : 17098818, PubMed : 17568691). By also promoting the amplification of inflammatory signals that are initially triggered by Toll-like receptor (TLR) and NOD-like receptor engagement, plays a major role in the pathophysiology of acute and chronic inflammatory diseases of different etiologies including septic shock and atherosclerosis (PubMed : 11323674, PubMed : 21393102).. Isoform 2. Acts as a decoy receptor, counterbalancing TREM1 pro-inflammatory activity through the neutralization of its ligand.

Post-translational modifications

Glycosylated.

Product protocols

Target data

Isoform 1. Cell surface receptor that plays important roles in innate and adaptive immunity by amplifying inflammatory responses (PubMed : 10799849, PubMed : 21393102). Upon activation by various ligands such as PGLYRP1, HMGB1 or HSP70, multimerizes and forms a complex with transmembrane adapter TYROBP/DAP12 (PubMed : 17568691, PubMed : 25595774, PubMed : 29568119). In turn, initiates a SYK-mediated cascade of tyrosine phosphorylation, activating multiple downstream mediators such as BTK, MAPK1, MAPK3 or phospholipase C-gamma (PubMed : 14656437, PubMed : 21659545). This cascade promotes the neutrophil- and macrophage-mediated release of pro-inflammatory cytokines and/or chemokines, as well as their migration and thereby amplifies inflammatory responses that are triggered by bacterial and fungal infections (PubMed : 17098818, PubMed : 17568691). By also promoting the amplification of inflammatory signals that are initially triggered by Toll-like receptor (TLR) and NOD-like receptor engagement, plays a major role in the pathophysiology of acute and chronic inflammatory diseases of different etiologies including septic shock and atherosclerosis (PubMed : 11323674, PubMed : 21393102).. Isoform 2. Acts as a decoy receptor, counterbalancing TREM1 pro-inflammatory activity through the neutralization of its ligand.
See full target information TREM1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com