JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB176057

Recombinant Human TRIAP1 protein (His tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human TRIAP1 protein (His tag N-Terminus) is a Human Full Length protein, in the 1 to 76 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

15E1.1, HSPC132, TRIAP1, TP53-regulated inhibitor of apoptosis 1, Protein 15E1.1, WF-1, p53-inducible cell-survival factor, p53CSV

1 Images
SDS-PAGE - Recombinant Human TRIAP1 protein (His tag N-Terminus) (AB176057)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human TRIAP1 protein (His tag N-Terminus) (AB176057)

15% SDS-PAGE analysis of ab176057 (3μg).

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE, Mass Spec

applications

Biologically active

No

Accession

O43715

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 20% Glycerol (glycerin, glycerine), 0.58% Sodium chloride, 0.32% Tris-HCl buffer, 0.02% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMGSMNSVGEACTDMKREYDQCFNRWFAEKFLKGDSSGDPCTDLFKRYQQCVQKAIKEKEIPIEGLEFMGHGKEKPENSS","proteinLength":"Full Length","predictedMolecularWeight":"11.2 kDa","actualMolecularWeight":null,"aminoAcidEnd":76,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"O43715","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

TRIAP1 also known as p53-regulated apoptosis-inducing protein 1 is a small protein with a mass of approximately 10 kDa. This protein is expressed in various tissues particularly those with high proliferative activity. TRIAP1 interacts with key components of cytochrome c release and helps to regulate the mitochondria's response to apoptotic signals. Its mechanical role is essential in cell survival and involves interactions with other proteins to stabilize the mitochondrial outer membrane.
Biological function summary

TRIAP1 is involved in maintaining mitochondrial function and promoting cell survival under stress conditions. It plays a significant role by forming a complex with other mitochondrial proteins such as PRELID1 which is involved in lipid transfer and homeostasis. This protein regulates the release of apoptogenic factors from mitochondria therefore controlling the intrinsic apoptosis pathway. Additionally TRIAP1's activity facilitates the stabilization of mitochondrial membranes against stress-induced depolarization.

Pathways

TRIAP1 plays an important role in the intrinsic apoptosis pathway where it prevents mitochondrial outer membrane permeabilization. It is closely related to the p53 signaling pathway as p53 regulates TRIAP1 expression levels in response to cellular stress. Through this pathway TRIAP1 collaborates with proteins like BCL-2 family members to maintain mitochondrial integrity and prevent apoptosis ensuring cellular homeostasis under stress conditions.

TRIAP1 has been implicated in cancer development where its overexpression correlates with resistance to apoptosis in tumor cells. Its interaction with p53 and BCL-2 family members influences tumor progression and treatment resistance making it relevant in certain cancers like breast and ovarian cancer. Furthermore TRIAP1's involvement in metabolic disorders is observed through its role in maintaining mitochondrial function which can affect conditions such as mitochondrial dysfunction syndromes. Understanding these connections may offer insights into targeted therapeutic interventions.

Specifications

Form

Liquid

Additional notes

ab176057 is purified using conventional chromatography techniques.

General info

Function

Involved in the modulation of the mitochondrial apoptotic pathway by ensuring the accumulation of cardiolipin (CL) in mitochondrial membranes. In vitro, the TRIAP1 : PRELID1 complex mediates the transfer of phosphatidic acid (PA) between liposomes and probably functions as a PA transporter across the mitochondrion intermembrane space to provide PA for CL synthesis in the inner membrane (PubMed : 23931759). Likewise, the TRIAP1 : PRELID3A complex mediates the transfer of phosphatidic acid (PA) between liposomes (in vitro) and probably functions as a PA transporter across the mitochondrion intermembrane space (in vivo) (PubMed : 26071602). Mediates cell survival by inhibiting activation of caspase-9 which prevents induction of apoptosis (PubMed : 15735003).

Sequence similarities

Belongs to the TRIAP1/MDM35 family.

Subcellular localisation

Mitochondrion

Product protocols

Target data

Involved in the modulation of the mitochondrial apoptotic pathway by ensuring the accumulation of cardiolipin (CL) in mitochondrial membranes. In vitro, the TRIAP1 : PRELID1 complex mediates the transfer of phosphatidic acid (PA) between liposomes and probably functions as a PA transporter across the mitochondrion intermembrane space to provide PA for CL synthesis in the inner membrane (PubMed : 23931759). Likewise, the TRIAP1 : PRELID3A complex mediates the transfer of phosphatidic acid (PA) between liposomes (in vitro) and probably functions as a PA transporter across the mitochondrion intermembrane space (in vivo) (PubMed : 26071602). Mediates cell survival by inhibiting activation of caspase-9 which prevents induction of apoptosis (PubMed : 15735003).
See full target information TRIAP1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com