JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB159807

Recombinant Human TRPV1 protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human TRPV1 protein is a Human Fragment protein, in the 21 to 124 aa range, expressed in Wheat germ, suitable for ELISA, WB.

View Alternative Names

VR1, TRPV1, Transient receptor potential cation channel subfamily V member 1, TrpV1, Capsaicin receptor, Osm-9-like TRP channel 1, Vanilloid receptor 1, OTRPC1

1 Images
SDS-PAGE - Recombinant Human TRPV1 protein (AB159807)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human TRPV1 protein (AB159807)

ab159807 on a 12.5% SDS-PAGE stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

WB, ELISA

applications

Biologically active

No

Accession

Q8NER1

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"CPDPLDGDPNSRPPPAKPQLSTAKSRTRLFGKGDSEEAFPVDCPHEEGELDSCPTITVSPVITIQRPGDGPTGARLLSQDSVAASTEKTLRLYDRRSIFEAVAQ","proteinLength":"Fragment","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":124,"aminoAcidStart":21,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"Q8NER1","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

TRPV1 also known as the transient receptor potential vanilloid 1 or capsaicin receptor is a non-selective cation channel with a molecular mass of approximately 95 kDa. It acts mechanically by allowing the influx of calcium and sodium ions upon activation. This receptor is expressed predominantly in sensory neurons specifically in dorsal root ganglia and trigeminal ganglia which are key regions involved in pain perception. TRPV1 can also be found in various non-neuronal tissues influencing a range of physiological responses.
Biological function summary

The role of TRPV1 extends beyond sensory perception. It is involved in detecting and regulating body temperature and is activated by heat acidic conditions and certain lipid metabolites. The receptor operates as part of a homotetrameric complex contributing to neural signaling. It is activated by chemical ligands such as capsaicin the compound responsible for the spicy sensation in chili peppers influencing pain and inflammation pathways.

Pathways

TRPV1 plays essential roles in pain and nociception pathways. It intersects with the inflammatory pathway where its activity is modulated by protein kinase C (PKC) and phospholipase C (PLC). These pathways involve calcium signaling and relate to proteins such as PKA and calcineurin which modulate TRPV1 activity through phosphorylation and dephosphorylation affecting the body's response to noxious stimuli.

TRPV1 is a critical player in pain management and inflammatory disorders. It has been linked to chronic pain conditions like neuropathic pain and is also involved in migraine pathophysiology. In these contexts TRPV1 interacts with proteins like CGRP and TRPA1 which are also implicated in pain signaling and migraine mechanisms. Antagonists such as capsazepine AMG 9810 and AMG-517 have been researched for therapeutic targeting of TRPV1 in these disorders.

Specifications

Form

Liquid

General info

Function

Ligand-activated non-selective calcium permeant cation channel involved in detection of noxious chemical and thermal stimuli. Seems to mediate proton influx and may be involved in intracellular acidosis in nociceptive neurons. Involved in mediation of inflammatory pain and hyperalgesia. Sensitized by a phosphatidylinositol second messenger system activated by receptor tyrosine kinases, which involves PKC isozymes and PCL. Activation by vanilloids, like capsaicin, and temperatures higher than 42 degrees Celsius, exhibits a time- and Ca(2+)-dependent outward rectification, followed by a long-lasting refractory state. Mild extracellular acidic pH (6.5) potentiates channel activation by noxious heat and vanilloids, whereas acidic conditions (pH <6) directly activate the channel. Can be activated by endogenous compounds, including 12-hydroperoxytetraenoic acid and bradykinin. Acts as ionotropic endocannabinoid receptor with central neuromodulatory effects. Triggers a form of long-term depression (TRPV1-LTD) mediated by the endocannabinoid anandamine in the hippocampus and nucleus accumbens by affecting AMPA receptors endocytosis.

Sequence similarities

Belongs to the transient receptor (TC 1.A.4) family. TrpV subfamily. TRPV1 sub-subfamily.

Post-translational modifications

Phosphorylation by PKA reverses capsaicin-induced dephosphorylation at multiple sites, probably including Ser-117 as a major phosphorylation site. Phosphorylation by CAMKII seems to regulate binding to vanilloids. Phosphorylated and modulated by PRKCE, PRKCM and probably PRKCZ. Dephosphorylation by calcineurin seems to lead to receptor desensitization and phosphorylation by CAMKII recovers activity.

Product protocols

Target data

Ligand-activated non-selective calcium permeant cation channel involved in detection of noxious chemical and thermal stimuli. Seems to mediate proton influx and may be involved in intracellular acidosis in nociceptive neurons. Involved in mediation of inflammatory pain and hyperalgesia. Sensitized by a phosphatidylinositol second messenger system activated by receptor tyrosine kinases, which involves PKC isozymes and PCL. Activation by vanilloids, like capsaicin, and temperatures higher than 42 degrees Celsius, exhibits a time- and Ca(2+)-dependent outward rectification, followed by a long-lasting refractory state. Mild extracellular acidic pH (6.5) potentiates channel activation by noxious heat and vanilloids, whereas acidic conditions (pH <6) directly activate the channel. Can be activated by endogenous compounds, including 12-hydroperoxytetraenoic acid and bradykinin. Acts as ionotropic endocannabinoid receptor with central neuromodulatory effects. Triggers a form of long-term depression (TRPV1-LTD) mediated by the endocannabinoid anandamine in the hippocampus and nucleus accumbens by affecting AMPA receptors endocytosis.
See full target information TRPV1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com