JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB276679

Recombinant Human Tspan-8 protein (Fc Chimera)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human Tspan-8 protein (Fc Chimera) is a Human Fragment protein, in the 110 to 205 aa range, expressed in HEK 293 cells, with >95%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE.

View Alternative Names

TM4SF3, TSPAN8, Tetraspanin-8, Tspan-8, Transmembrane 4 superfamily member 3, Tumor-associated antigen CO-029

1 Images
SDS-PAGE - Recombinant Human Tspan-8 protein (Fc Chimera) (AB276679)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human Tspan-8 protein (Fc Chimera) (AB276679)

SDS-PAGE analysis of ab276679

Key facts

Purity

>95% SDS-PAGE

Endotoxin level

< 1 EU/µg

Expression system

HEK 293 cells

Tags

Fc tag N-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

P19075

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.4 Constituents: 100% PBS

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"KSKSDRIVNETLYENTKLLSATGESEKQFQEAIIVFQEEFKCCGLVNGAADWGNNFQHYPELCACLDKQRPCQSYNGKQVYKETCISFIKDFLAKN","proteinLength":"Fragment","predictedMolecularWeight":"37.6 kDa","actualMolecularWeight":null,"aminoAcidEnd":205,"aminoAcidStart":110,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"P19075","tags":[{"tag":"Fc","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Ambient - Can Ship with Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Tspan-8 also known as Tetraspanin-8 is a protein with a mass of about 27 kDa. This protein belongs to the tetraspanin family characterized by four transmembrane domains. Tspan-8 is expressed in various tissues including the gastrointestinal tract kidney and lung with notable expression in human tumors. It localizes to membranes where it participates in organizing specific microdomains essential for cellular activities like adhesion and migration.
Biological function summary

Tspan-8 impacts several cellular functions such as motility and invasion. It often acts as part of a complex interacting with integrins and other tetraspanins. Through these interactions Tspan-8 facilitates communication between the extracellular matrix and the cytoskeleton. This interaction affects processes like cellular attachment and extracellular matrix remodeling contributing to its functions in normal physiological and pathological conditions.

Pathways

Numerous studies tie Tspan-8 to significant biological pathways particularly those involved in signal transduction and cellular movement. It connects closely with the integrin signaling pathway influencing cellular responses to external signals. In this context Tspan-8 interacts with proteins such as integrin αvβ6 contributing to diverse cellular outcomes. Additionally its role within the epithelial-to-mesenchymal transition (EMT) pathway is relevant for its function in cell plasticity and migration.

Tspan-8 links to cancer and inflammatory conditions. Its overexpression associates with tumor progression and metastasis particularly in cancers like colorectal and pancreatic cancer. The protein's interactions with integrin partners notably integrin αvβ6 could enhance cancer cell invasiveness. Moreover inflammation-related diseases might involve Tspan-8 through its influence on inflammatory cell trafficking and invasion contributing to disease pathology. Understanding these interactions can provide insights into novel therapeutic targets.

Specifications

Form

Lyophilized

General info

Function

Structural component of specialized membrane microdomains known as tetraspanin-enriched microdomains (TERMs), which act as platforms for receptor clustering and signaling (PubMed : 27180357, PubMed : 36078095). Participates thereby in diverse biological functions such as cell signal transduction, migration and protein trafficking (PubMed : 25761241). Promotes ADAM17-mediated TNF-alpha processing through recruitment of ADAM17 to tetraspanin-enriched micro-domains (TEMs) (PubMed : 36078095). Forms a complex with RICTOR and integrin alpha3/ITGA3 to mediate mTORC2 activation and AKT1 phosphorylation leading to cell migration (PubMed : 25761241). Reduces apoptosis and autophagy induced by high glucose levels through forming a complex with mTOR and RICTOR (PubMed : 35904232). Contributes to the maintenance of intestinal epithelial barrier and plays a role in the regulation of intestine inflammation by switching interferon gamma receptor 1/IFNGR1 from clathrin-dependent to lipid raft-dependent endocytosis route to limit STAT1 activation magnitude and duration (PubMed : 37204469). Acts as a modulator of the endothelin axis by associating with endothelin converting enzyme ECE1 and regulating its activity of conversion of the endothelin-1 precursor to endothelin (PubMed : 37835445).

Sequence similarities

Belongs to the tetraspanin (TM4SF) family.

Product protocols

Target data

Structural component of specialized membrane microdomains known as tetraspanin-enriched microdomains (TERMs), which act as platforms for receptor clustering and signaling (PubMed : 27180357, PubMed : 36078095). Participates thereby in diverse biological functions such as cell signal transduction, migration and protein trafficking (PubMed : 25761241). Promotes ADAM17-mediated TNF-alpha processing through recruitment of ADAM17 to tetraspanin-enriched micro-domains (TEMs) (PubMed : 36078095). Forms a complex with RICTOR and integrin alpha3/ITGA3 to mediate mTORC2 activation and AKT1 phosphorylation leading to cell migration (PubMed : 25761241). Reduces apoptosis and autophagy induced by high glucose levels through forming a complex with mTOR and RICTOR (PubMed : 35904232). Contributes to the maintenance of intestinal epithelial barrier and plays a role in the regulation of intestine inflammation by switching interferon gamma receptor 1/IFNGR1 from clathrin-dependent to lipid raft-dependent endocytosis route to limit STAT1 activation magnitude and duration (PubMed : 37204469). Acts as a modulator of the endothelin axis by associating with endothelin converting enzyme ECE1 and regulating its activity of conversion of the endothelin-1 precursor to endothelin (PubMed : 37835445).
See full target information TSPAN8

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com