JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB276497

Recombinant Human TSPAN1 protein (Fc Chimera)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human TSPAN1 protein (Fc Chimera) is a Human Fragment protein, in the 110 to 211 aa range, expressed in HEK 293 cells, with >90%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE.

View Alternative Names

Tetraspanin-1, Tspan-1, Tetraspan NET-1, Tetraspanin TM4-C, TSPAN1

1 Images
SDS-PAGE - Recombinant Human TSPAN1 protein (Fc Chimera) (AB276497)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human TSPAN1 protein (Fc Chimera) (AB276497)

SDS-PAGE analysis of ab276497

Key facts

Purity

>90% SDS-PAGE

Endotoxin level

< 1 EU/µg

Expression system

HEK 293 cells

Tags

Fc tag N-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

O60635

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.4 Constituents: 100% PBS

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"YTTMAEHFLTLLVVPAIKKDYGSQEDFTQVWNTTMKGLKCCGFTNYTDFEDSPYFKENSAFPPFCCNDNVTNTANETCTKQKAHDQKVEGCFNQLLYDIRTN","proteinLength":"Fragment","predictedMolecularWeight":"38.4 kDa","actualMolecularWeight":null,"aminoAcidEnd":211,"aminoAcidStart":110,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"O60635","tags":[{"tag":"Fc","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Ambient - Can Ship with Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

TSPAN1 also known as Tetraspanin-1 is a protein encoded by the TSPAN1 gene. It is part of the tetraspanin family and is characterized by four transmembrane domains. This protein has a mass of approximately 25 kDa. TSPAN1 is mainly expressed in epithelial tissues including the skin lung and gastrointestinal tract. By forming complexes with other proteins TSPAN1 integrally contributes to various cellular processes like proliferation adhesion and migration through its role in organizing the cell membrane microdomains.
Biological function summary

TSPAN1 interacts with cell surface proteins to regulate important cellular activities. A notable characteristic of TSPAN1 is its involvement in the formation of the tetraspanin-enriched microdomains (TEMs). These microdomains facilitate interactions between various cell surface receptors and signaling molecules. This formation often includes integrins which play an important role in cell adhesion and signal transduction. TSPAN1 influences processes such as cell migration invasion and proliferation typically by modulating the activity of these integrins within the TEMs.

Pathways

TSPAN1 modulates the PI3K/Akt signaling pathway. The protein interacts with other tetraspanins and integrins to affect this signaling cascade which is critical for cell growth and survival. Additionally TSPAN1 connects with other signaling pathways that involve proteins like E-cadherin affecting cell-to-cell junctions and impacting epithelial integrity and function. These pathways highlight the diverse roles of TSPAN1 in maintaining cellular structure and function through its interactions.

TSPAN1 shows strong associations with cancer progression particularly in gastric and colorectal cancers. The protein's role in cell proliferation and migration links it to these malignancies often showing overexpression in tumor tissues. In these cancers TSPAN1 interacts with proteins like integrins and PI3K driving oncogenic processes. Alterations in TSPAN1 expression or function may relate to disease prognosis indicating its potential as a biomarker or therapeutic target in cancer-related research.

Specifications

Form

Lyophilized

General info

Function

Structural component of specialized membrane microdomains known as tetraspanin-enriched microdomains (TERMs), which act as platforms for receptor clustering and signaling. Participates thereby in diverse biological functions such as cell signal transduction, adhesion, migration and protein trafficking (PubMed : 30066932, PubMed : 30291375). Regulates neuronal differentiation in response to NGF by facilitating NGF-mediated activation of NTRK1/TRKA receptor tyrosine kinase and subsequent downstream signaling pathways (By similarity). Plays a role in the inhibition of TNFalpha-induced apoptosis. Mechanistically, inhibits the NF-kappa-B signaling pathway by blocking phosphorylation of CHUK (PubMed : 30291375). Promotes also the stability of the thiamine transporter 1/SLC19A2 in intestinal epithelial cells leading to an increase of thiamine uptake process (PubMed : 21836059).

Sequence similarities

Belongs to the tetraspanin (TM4SF) family.

Subcellular localisation

Lysosome membrane

Product protocols

Target data

Structural component of specialized membrane microdomains known as tetraspanin-enriched microdomains (TERMs), which act as platforms for receptor clustering and signaling. Participates thereby in diverse biological functions such as cell signal transduction, adhesion, migration and protein trafficking (PubMed : 30066932, PubMed : 30291375). Regulates neuronal differentiation in response to NGF by facilitating NGF-mediated activation of NTRK1/TRKA receptor tyrosine kinase and subsequent downstream signaling pathways (By similarity). Plays a role in the inhibition of TNFalpha-induced apoptosis. Mechanistically, inhibits the NF-kappa-B signaling pathway by blocking phosphorylation of CHUK (PubMed : 30291375). Promotes also the stability of the thiamine transporter 1/SLC19A2 in intestinal epithelial cells leading to an increase of thiamine uptake process (PubMed : 21836059).
See full target information Tetraspanin-1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com