JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB167894

Recombinant Human TTC35 protein (His tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human TTC35 protein (His tag N-Terminus) is a Human Full Length protein, in the 1 to 297 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

KIAA0103, TTC35, EMC2, ER membrane protein complex subunit 2, Tetratricopeptide repeat protein 35, TPR repeat protein 35

1 Images
SDS-PAGE - Recombinant Human TTC35 protein (His tag N-Terminus) (AB167894)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human TTC35 protein (His tag N-Terminus) (AB167894)

15% SDS-PAGE of ab167894 (3µg)

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

Mass Spec, SDS-PAGE

applications

Biologically active

No

Accession

Q15006

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 40% Glycerol (glycerin, glycerine), 0.88% Sodium chloride, 0.32% Tris HCl, 0.03% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMGSMAKVSELYDVTWEEMRDKMRKWREENSRNSEQIVEVGEELINEYASKLGDDIWIIYEQVMIAALDYGRDDLALFCLQELRRQFPGSHRVKRLTGMRFEAMERYDDAIQLYDRILQEDPTNTAARKRKIAIRKAQGKNVEAIRELNEYLEQFVGDQEAWHELAELYINEHDYAKAAFCLEELMMTNPHNHLYCQQYAEVKYTQGGLENLELSRKYFAQALKLNNRNMRALFGLYMSASHIASNPKASAKTKKDNMKYASWAASQINRAYQFAGRSKKETKYSLKAVEDMLETLQITQS","proteinLength":"Full Length","predictedMolecularWeight":"37.2 kDa","actualMolecularWeight":null,"aminoAcidEnd":297,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q15006","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

TTC35 also known as tetratricopeptide repeat protein 35 plays a mechanical role in cellular processes. This protein weighs approximately 35 kDa and is expressed in many human tissues including the liver and kidney. Researchers have identified TTC35 through its essential tetratricopeptide repeat domains which facilitate protein-protein interactions important for cellular homeostasis.
Biological function summary

As an integral component of multiple intracellular complexes TTC35 influences protein folding and stability. TTC35 has been found in the context of chaperone protein complexes where it assists in the maintenance of proper protein conformation. This effect on protein conformation plays a direct role in preventing protein aggregation which can be harmful to cells.

Pathways

TTC35 impacts molecular pathways involved in protein quality control and stress responses. It intersects with pathways like the unfolded protein response (UPR) and is linked to proteins such as HSP70 a critical player in cellular stress management. TTC35's involvement in these pathways helps ensure that proteins remain correctly folded and functional under stressful conditions.

TTC35's alteration associates with neurodegenerative diseases including Alzheimer's disease and Huntington’s disease. Misregulation of TTC35 or its pathway components like HSP70 can result in protein misfolding and aggregation contributing to disease progression. Undoubtedly understanding TTC35's role in these contexts opens the door to potential therapeutic strategies.

Specifications

Form

Liquid

Additional notes

ab167894 is purified using conventional chromatography techniques.

General info

Function

Part of the endoplasmic reticulum membrane protein complex (EMC) that enables the energy-independent insertion into endoplasmic reticulum membranes of newly synthesized membrane proteins (PubMed : 29242231, PubMed : 29809151, PubMed : 30415835, PubMed : 32439656, PubMed : 32459176, PubMed : 33964204). Preferentially accommodates proteins with transmembrane domains that are weakly hydrophobic or contain destabilizing features such as charged and aromatic residues (PubMed : 29242231, PubMed : 29809151, PubMed : 30415835). Involved in the cotranslational insertion of multi-pass membrane proteins in which stop-transfer membrane-anchor sequences become ER membrane spanning helices (PubMed : 29809151, PubMed : 30415835). It is also required for the post-translational insertion of tail-anchored/TA proteins in endoplasmic reticulum membranes (PubMed : 29242231, PubMed : 29809151). By mediating the proper cotranslational insertion of N-terminal transmembrane domains in an N-exo topology, with translocated N-terminus in the lumen of the ER, controls the topology of multi-pass membrane proteins like the G protein-coupled receptors (PubMed : 30415835). By regulating the insertion of various proteins in membranes, it is indirectly involved in many cellular processes (Probable).

Sequence similarities

Belongs to the EMC2 family.

Post-translational modifications

Ubiquitinated when soluble in the cytoplasm, leading to its degradation by the proteasome (PubMed:33964204). Interaction with EMC2 prevents its ubiquitination and degradation (PubMed:33964204).

Product protocols

Target data

Part of the endoplasmic reticulum membrane protein complex (EMC) that enables the energy-independent insertion into endoplasmic reticulum membranes of newly synthesized membrane proteins (PubMed : 29242231, PubMed : 29809151, PubMed : 30415835, PubMed : 32439656, PubMed : 32459176, PubMed : 33964204). Preferentially accommodates proteins with transmembrane domains that are weakly hydrophobic or contain destabilizing features such as charged and aromatic residues (PubMed : 29242231, PubMed : 29809151, PubMed : 30415835). Involved in the cotranslational insertion of multi-pass membrane proteins in which stop-transfer membrane-anchor sequences become ER membrane spanning helices (PubMed : 29809151, PubMed : 30415835). It is also required for the post-translational insertion of tail-anchored/TA proteins in endoplasmic reticulum membranes (PubMed : 29242231, PubMed : 29809151). By mediating the proper cotranslational insertion of N-terminal transmembrane domains in an N-exo topology, with translocated N-terminus in the lumen of the ER, controls the topology of multi-pass membrane proteins like the G protein-coupled receptors (PubMed : 30415835). By regulating the insertion of various proteins in membranes, it is indirectly involved in many cellular processes (Probable).
See full target information EMC2

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com