JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB187616

Recombinant Human TTDA protein (His tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human TTDA protein (His tag N-Terminus) is a Human Full Length protein, in the 1 to 71 aa range, expressed in Escherichia coli, with >95%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

C6orf175, TTDA, GTF2H5, General transcription factor IIH subunit 5, General transcription factor IIH polypeptide 5, TFB5 ortholog, TFIIH basal transcription factor complex TTD-A subunit, TFIIH subunit p8

1 Images
SDS-PAGE - Recombinant Human TTDA protein (His tag N-Terminus) (AB187616)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human TTDA protein (His tag N-Terminus) (AB187616)

15% SDS-PAGE (ab187616 at 3μg)

Key facts

Purity

>95% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

Mass Spec, SDS-PAGE

applications

Biologically active

No

Accession

Q6ZYL4

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.4 Constituents: PBS, 10% Glycerol (glycerin, glycerine)

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMGSMVNVLKGVLIECDPAMKQFLLYLDESNALGKKFIIQDIDDTHVFVIAELVNVLQERVGELMDQNAFSLTQK","proteinLength":"Full Length","predictedMolecularWeight":"10.4 kDa","actualMolecularWeight":null,"aminoAcidEnd":71,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q6ZYL4","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

TTDA also known as GTF2H5 or TFB5 is a small protein with a mass of approximately 8.4 kDa. It functions as a part of the transcription factor IIH (TFIIH) complex which is essential in DNA repair and transcription. TTDA is expressed in various tissues throughout the body with notable expression in actively dividing cells. Mechanically TTDA interacts with other components within the TFIIH complex to stabilize its structure and support its activities during transcription and nucleotide excision repair (NER).
Biological function summary

This protein plays a role in maintaining genomic integrity by ensuring effective DNA repair. Acting as part of the TFIIH complex TTDA facilitates the recognition and excision of damaged DNA segments through the NER process. It also contributes to the transcription initiation process by unwinding DNA and permitting the RNA polymerase to access the DNA template. These roles are critical for cellular processes like replication and transcription which require accurate and clean DNA templates.

Pathways

TTDA is important in the nucleotide excision repair and transcription initiation pathways. Within the NER pathway TTDA works alongside other TFIIH complex members such as XPB and XPD which helicases that help unwind DNA. In transcription initiation TTDA is related to the functioning of RNA polymerase II ensuring successful transcription starts. The interconnection of TTDA with these processes highlights its contribution to cellular health and replication fidelity.

Mutations or dysfunctions regarding TTDA can lead to conditions such as trichothiodystrophy and xeroderma pigmentosum. These disorders arise from impaired DNA repair mechanisms due to faulty TFIIH complex activities leading to increased sensitivity to UV light and abnormal skin and hair development. TTDA's interaction with other NER proteins like XPD suggests its involvement in maintaining a robust response to DNA damage and its malfunction can contribute to the onset of these genetic disorders.

Specifications

Form

Liquid

General info

Function

Component of the general transcription and DNA repair factor IIH (TFIIH) core complex, which is involved in general and transcription-coupled nucleotide excision repair (NER) of damaged DNA and, when complexed to CAK, in RNA transcription by RNA polymerase II. In NER, TFIIH acts by opening DNA around the lesion to allow the excision of the damaged oligonucleotide and its replacement by a new DNA fragment. In transcription, TFIIH has an essential role in transcription initiation. When the pre-initiation complex (PIC) has been established, TFIIH is required for promoter opening and promoter escape. Phosphorylation of the C-terminal tail (CTD) of the largest subunit of RNA polymerase II by the kinase module CAK controls the initiation of transcription. Necessary for the stability of the TFIIH complex and for the presence of normal levels of TFIIH in the cell.

Sequence similarities

Belongs to the TFB5 family.

Subcellular localisation

Nucleus

Product protocols

Target data

Component of the general transcription and DNA repair factor IIH (TFIIH) core complex, which is involved in general and transcription-coupled nucleotide excision repair (NER) of damaged DNA and, when complexed to CAK, in RNA transcription by RNA polymerase II. In NER, TFIIH acts by opening DNA around the lesion to allow the excision of the damaged oligonucleotide and its replacement by a new DNA fragment. In transcription, TFIIH has an essential role in transcription initiation. When the pre-initiation complex (PIC) has been established, TFIIH is required for promoter opening and promoter escape. Phosphorylation of the C-terminal tail (CTD) of the largest subunit of RNA polymerase II by the kinase module CAK controls the initiation of transcription. Necessary for the stability of the TFIIH complex and for the presence of normal levels of TFIIH in the cell.
See full target information GTF2H5

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com