JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB164331

Recombinant Human TXNDC/TMX protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human TXNDC/TMX protein is a Human Full Length protein, in the 1 to 280 aa range, expressed in Wheat germ, suitable for ELISA, WB.

View Alternative Names

TMX, TXNDC, TXNDC1, PSEC0085, UNQ235/PRO268, TMX1, Thioredoxin-related transmembrane protein 1, Protein disulfide-isomerase TMX1, Thioredoxin domain-containing protein 1, Transmembrane Trx-related protein

1 Images
SDS-PAGE - Recombinant Human TXNDC/TMX protein (AB164331)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human TXNDC/TMX protein (AB164331)

ab164331 on a 12.5% SDS-PAGE stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

ELISA, WB

applications

Biologically active

No

Accession

Q9H3N1

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

This product was previously labelled as TXNDC.

Sequence info

[{"sequence":"MAPSGSLAVPLAVMVPLLWGAPWTHGRRSNVRVITDENWRELLEGDWMIEFYAPWCPACQNLQPEWESFAEWGEDLEVNIAKVDVTEQPGLSGRFIINALPTIYHCKDGEFRRYQGPRTKKDFINFISDKEWKSIEPVSSWFGPGSVLMSSMSALFQLSMWIRTCHNYFIEDLGLPVWGSYTVFALATLFSGLLLGLCMIFVADCLCPSKRRRPQPYPYPSKKLLSESAQPLKKVEEEQEADEEDVSEEEAESKEGTNKDFPQNAIRQRSLGPSLATDKS","proteinLength":"Full Length","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":280,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"Q9H3N1","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

TXNDC also known as TMX or thioredoxin domain-containing protein is a protein with enzymatic properties. This protein functions as a disulfide isomerase and is involved in the formation and rearrangement of disulfide bonds within proteins. TXNDC weighs around 38 kDa and localizes primarily in the endoplasmic reticulum (ER). TXNDC facilitates oxidative protein folding by catalyzing thiol-disulfide exchange reactions. Its expression is common in tissues with high protein synthesis demand such as liver and pancreas.
Biological function summary

Thioredoxin domain-containing protein plays a significant role in maintaining cellular redox homeostasis. It forms part of a complex network with other oxidoreductases contributing to oxidative protein folding processes essential for proper protein maturation and function. Beyond protein folding TXNDC participates in the detoxification of reactive oxygen species helping protect cells from oxidative stress. This function supports normal cellular metabolism and survival under potentially damaging conditions.

Pathways

TXNDC is active within the oxidative protein folding pathway which involves the transfer of electrons from substrate proteins to the molecular oxidant. It collaborates closely with protein disulfide isomerase (PDI) in this pathway to ensure proper protein structure and function. Another significant pathway includes its involvement in the unfolded protein response (UPR) a mechanism that manages protein misfolding stress in the ER. TXNDC modulates the UPR by influencing the levels of reactive oxygen species indirectly impacting the function of pathways regulated by proteins such as IRE1 and PERK.

Alterations in TXNDC function have connections to several pathological conditions. One such condition is cancer where imbalances in TXNDC expression levels can contribute to tumor progression and chemoresistance often in coordination with other redox proteins like thioredoxin itself. Additionally improper TXNDC function can relate to neurodegenerative diseases such as Alzheimer's as oxidative stress and protein misfolding are common features. In Alzheimer's TXNDC's involvement in redox regulation and protein homeostasis links it to the broader pathology involving proteins like amyloid-beta and tau.

Specifications

Form

Liquid

General info

Function

Thiredoxin domain-containing protein that participates in various redox reactions through the reversible oxidation of its active center dithiol to a disulfide and catalyze dithiol-disulfide exchange reactions (PubMed : 11152479, PubMed : 37648867). Acts as a key inhibitor of the alternative triglyceride biosynthesis pathway by inhibiting the activity of TMEM68/DIESL at the endoplasmic reticulum, thereby restricting accumulation of triacylglycerol (PubMed : 37648867). The alternative triglyceride biosynthesis pathway mediates formation of triacylglycerol from diacylglycerol and membrane phospholipids (PubMed : 37648867). Acts as a protein disulfide isomerase by catalyzing formation or reduction of disulfide bonds (PubMed : 22228764, PubMed : 29932915). Specifically mediates formation of disulfide bonds of transmembrane proteins at the endoplasmic reticulum membrane (PubMed : 22228764). Involved in endoplasmic reticulum-associated degradation (ERAD) via its protein disulfide isomerase activity by acting on folding-defective polypeptides at the endoplasmic reticulum membrane (PubMed : 29932915). Acts as a negative regulator of platelet aggregation following secretion in the extracellular space (PubMed : 30425049). Acts as a regulator of endoplasmic reticulum-mitochondria contact sites via its ability to regulate redox signals (PubMed : 27502484, PubMed : 31304984). Regulates endoplasmic reticulum-mitochondria Ca(2+) flux (PubMed : 27502484).

Post-translational modifications

Palmitoylated; palmitoylation is required for localization to mitochondria-associated endoplasmic reticulum membrane (MAM).

Product protocols

Target data

Thiredoxin domain-containing protein that participates in various redox reactions through the reversible oxidation of its active center dithiol to a disulfide and catalyze dithiol-disulfide exchange reactions (PubMed : 11152479, PubMed : 37648867). Acts as a key inhibitor of the alternative triglyceride biosynthesis pathway by inhibiting the activity of TMEM68/DIESL at the endoplasmic reticulum, thereby restricting accumulation of triacylglycerol (PubMed : 37648867). The alternative triglyceride biosynthesis pathway mediates formation of triacylglycerol from diacylglycerol and membrane phospholipids (PubMed : 37648867). Acts as a protein disulfide isomerase by catalyzing formation or reduction of disulfide bonds (PubMed : 22228764, PubMed : 29932915). Specifically mediates formation of disulfide bonds of transmembrane proteins at the endoplasmic reticulum membrane (PubMed : 22228764). Involved in endoplasmic reticulum-associated degradation (ERAD) via its protein disulfide isomerase activity by acting on folding-defective polypeptides at the endoplasmic reticulum membrane (PubMed : 29932915). Acts as a negative regulator of platelet aggregation following secretion in the extracellular space (PubMed : 30425049). Acts as a regulator of endoplasmic reticulum-mitochondria contact sites via its ability to regulate redox signals (PubMed : 27502484, PubMed : 31304984). Regulates endoplasmic reticulum-mitochondria Ca(2+) flux (PubMed : 27502484).
See full target information TMX1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com