JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB271778

Recombinant human TYRO3 protein (Active) (GST tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant human TYRO3 protein (Active) (GST tag N-Terminus) is a Human Fragment protein, in the 455 to 890 aa range, expressed in Baculovirus infected Sf9 cells, with >55%, suitable for SDS-PAGE, FuncS.

View Alternative Names

BYK, DTK, RSE, SKY, TIF, TYRO3, Tyrosine-protein kinase receptor TYRO3, Tyrosine-protein kinase BYK, Tyrosine-protein kinase DTK, Tyrosine-protein kinase RSE, Tyrosine-protein kinase SKY, Tyrosine-protein kinase TIF

2 Images
Functional Studies - Recombinant human TYRO3 protein (Active) (GST tag N-Terminus) (AB271778)
  • FuncS

Supplier Data

Functional Studies - Recombinant human TYRO3 protein (Active) (GST tag N-Terminus) (AB271778)

Specific activity of ab271778 was 140 nmol/min/mg in a kinase assay using Poly-(Glu4 : Tyr) as substrate.

SDS-PAGE - Recombinant human TYRO3 protein (Active) (GST tag N-Terminus) (AB271778)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant human TYRO3 protein (Active) (GST tag N-Terminus) (AB271778)

SDS-PAGE analysis of ab271778.

Key facts

Purity

>55% SDS-PAGE

Expression system

Baculovirus infected Sf9 cells

Tags

GST tag N-Terminus

Applications

FuncS, SDS-PAGE

applications

Biologically active

Yes

Biological activity

Specific Activity: 140 nmol/min/mg.

Assay Conditions: Assay was done in Kinase buffer containing 2 mM DTT using Poly-(Glu4:Tyr) substrate (0.2 mg/ml) and 20 μM ATP. Reaction was performed at 30°C for 45 min. Amount of ATP transferred was calculated using Kinase-Glo reagent.

Accession

Q06418

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.5 Constituents: 20% Glycerol (glycerin, glycerine), 0.64% Sodium chloride, 0.63% Tris HCl, 0.05% Glutathione, 0.04% Sorbitan monolaurate, ethoxylated, 0.02% Potassium chloride

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"RKETRFGQAFDSVMARGEPAVHFRAARSFNRERPERIEATLDSLGISDELKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQLKQEDGSFVKVAVKMLKADIIASSDIEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGENPFNLPLQTLIRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVQSDVWAFGVTMWEIMTRGQTPYAGIENAEIYNYLIGGNRLKQPPECMEDVYDLMYQCWSADPKQRPSFTCLRMELENILGQLSVLSASQDPLYINIERAEEPTAGGSLELPGRDQPYSGAGDGSGMGAVGGTPSDCRYILTPGGLAEQPGQAEHQPESPLNETQRLLLLQQGLLPHSSC","proteinLength":"Fragment","predictedMolecularWeight":"77 kDa","actualMolecularWeight":null,"aminoAcidEnd":890,"aminoAcidStart":455,"nature":"Recombinant","expressionSystem":"Baculovirus infected Sf9 cells","accessionNumber":"Q06418","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Storage information
Avoid freeze / thaw cycle
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

TYRO3 also known as Tyrosine-protein kinase receptor TYRO3 is a membrane protein involved in various cellular processes. The protein has a molecular mass of approximately 104 kDa. TYRO3 expresses in a range of tissues with high levels noted in the central nervous system reproductive system and immune cells. The protein is part of the TAM family of receptor tyrosine kinases which includes AXL and MERTK and it participates in binding to specific ligands for signal transmission.
Biological function summary

TYRO3 influences multiple cellular activities such as cell survival proliferation and immune regulation. It acts within a signaling complex that includes ligands like Gas6 and Protein S. TYRO3 plays roles in phagocytosis of apoptotic cells and regulation of inflammatory responses. The protein's signaling pathways support tissue homeostasis and modulate immune responses making it an important player in maintaining cellular balance.

Pathways

TYRO3 is engaged in the PI3K/AKT and MAPK pathways which facilitate cell cycle progression and survival. In these pathways it interacts with other proteins such as AXL MERTK and downstream effectors like AKT and ERK. These interactions ensure proper cellular functions with TYRO3-mediated pathways contributing to normal cellular homeostasis and protective responses against stress.

Disruptions in TYRO3 function associate with cancer and autoimmune diseases. Its overexpression or mutations can lead to abnormal cell growth linking TYRO3 to certain cancers. The protein also intersects with immune-related disorders where an imbalance in TYRO3 signaling contributes to diseases like systemic lupus erythematosus. Proteins like AXL and MERTK closely related to TYRO3 often share these pathological associations emphasizing the interconnected nature of the TAM receptor family in disease pathogenesis.

Specifications

Form

Liquid

Additional notes

Affinity purified.

General info

Function

Receptor tyrosine kinase that transduces signals from the extracellular matrix into the cytoplasm by binding to several ligands including TULP1 or GAS6. Regulates many physiological processes including cell survival, migration and differentiation. Ligand binding at the cell surface induces dimerization and autophosphorylation of TYRO3 on its intracellular domain that provides docking sites for downstream signaling molecules. Following activation by ligand, interacts with PIK3R1 and thereby enhances PI3-kinase activity. Activates the AKT survival pathway, including nuclear translocation of NF-kappa-B and up-regulation of transcription of NF-kappa-B-regulated genes. TYRO3 signaling plays a role in various processes such as neuron protection from excitotoxic injury, platelet aggregation and cytoskeleton reorganization. Also plays an important role in inhibition of Toll-like receptors (TLRs)-mediated innate immune response by activating STAT1, which selectively induces production of suppressors of cytokine signaling SOCS1 and SOCS3.. (Microbial infection) Acts as a receptor for lassa virus and lymphocytic choriomeningitis virus, possibly through GAS6 binding to phosphatidyl-serine at the surface of virion envelope.. (Microbial infection) Acts as a receptor for Ebolavirus, possibly through GAS6 binding to phosphatidyl-serine at the surface of virion envelope.

Sequence similarities

Belongs to the protein kinase superfamily. Tyr protein kinase family. AXL/UFO subfamily.

Post-translational modifications

Autophosphorylated.

Product protocols

Target data

Receptor tyrosine kinase that transduces signals from the extracellular matrix into the cytoplasm by binding to several ligands including TULP1 or GAS6. Regulates many physiological processes including cell survival, migration and differentiation. Ligand binding at the cell surface induces dimerization and autophosphorylation of TYRO3 on its intracellular domain that provides docking sites for downstream signaling molecules. Following activation by ligand, interacts with PIK3R1 and thereby enhances PI3-kinase activity. Activates the AKT survival pathway, including nuclear translocation of NF-kappa-B and up-regulation of transcription of NF-kappa-B-regulated genes. TYRO3 signaling plays a role in various processes such as neuron protection from excitotoxic injury, platelet aggregation and cytoskeleton reorganization. Also plays an important role in inhibition of Toll-like receptors (TLRs)-mediated innate immune response by activating STAT1, which selectively induces production of suppressors of cytokine signaling SOCS1 and SOCS3.. (Microbial infection) Acts as a receptor for lassa virus and lymphocytic choriomeningitis virus, possibly through GAS6 binding to phosphatidyl-serine at the surface of virion envelope.. (Microbial infection) Acts as a receptor for Ebolavirus, possibly through GAS6 binding to phosphatidyl-serine at the surface of virion envelope.
See full target information TYRO3

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com