JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB99297

Recombinant Human UAP56 protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human UAP56 protein is a Human Full Length protein, in the 1 to 428 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

BAT1, UAP56, DDX39B, Spliceosome RNA helicase DDX39B, 56 kDa U2AF65-associated protein, ATP-dependent RNA helicase p47, DEAD box protein UAP56, HLA-B-associated transcript 1 protein

1 Images
SDS-PAGE - Recombinant Human UAP56 protein (AB99297)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human UAP56 protein (AB99297)

3ug by SDS-PAGE under reducing conditions and visualized by coomassie blue stain.

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE, Mass Spec

applications

Biologically active

No

Accession

Q13838

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 20% Glycerol (glycerin, glycerine), 0.58% Sodium chloride, 0.316% Tris HCl, 0.0154% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

style
left-column

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }
style
left-column
style
left-column

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMAENDVDNELLDYEDDEVETAAGGDGAEAPAKKDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLSIKKDEEVLKKNCPHIVVGTPGRILALARNKSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSKEIRPVCRKFMQDPMEIFVDDETKLTLHGLQQYYVKLKDNEKNRKLFDLLDVLEFNQVVIFVKSVQRCIALAQLLVEQNFPAIAIHRGMPQEERLSRYQQFKDFQRRILVATNLFGRGMDIERVNIAFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQDRFEVNISELPDEIDISSYIEQTR","proteinLength":"Full Length","predictedMolecularWeight":"51.1 kDa","actualMolecularWeight":null,"aminoAcidEnd":428,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q13838","tags":[{"tag":"His","terminus":"N-Terminus"}]}]
style
left-column

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False
style
left-column

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

UAP56 also known as DDX39B or SUB2 is an ATP-dependent RNA helicase with a molecular mass of approximately 46 kDa. It plays a significant role in RNA processing by unwinding RNA duplexes. UAP56 is found throughout the nucleus and functions in various cell types with high expression levels in actively dividing cells. It binds RNA substrates using ATP hydrolysis facilitating movement along RNA strands and this action is vital for splicing and mRNA export from the nucleus to the cytoplasm.
Biological function summary

This protein contributes to the assembly of the spliceosome complex which is essential for pre-mRNA splicing. By interacting with other splicing factors UAP56 ensures accurate removal of introns and the joining of exons in the mRNA. Its function is also necessary for the proper export of mRNA through the nuclear pore complex. Through these activities UAP56 supports gene expression by ensuring that only mature mRNA is available for translation.

Pathways

UAP56 operates in the mRNA processing and transport pathways. In the mRNA export pathway it collaborates with other proteins like Aly/REF and the TREX complex facilitating the translocation of mRNA from the nucleus to the cytoplasm. In the splicing pathway UAP56 interacts with small nuclear ribonucleoproteins (snRNPs) to ensure correct splicing. These interactions help maintain the efficiency and fidelity of gene expression.

Defects in UAP56 or its interactions may contribute to cancer and neurodegenerative diseases. In cancer abnormal mRNA export and splicing can lead to the expression of oncogenes or the loss of tumor suppressors implicating UAP56 in tumor progression. In neurodegenerative disorders UAP56 dysfunction might result in improper mRNA processing leading to the accumulation of misfolded proteins. Its role is related to proteins such as TDP-43 which is involved in neurodegenerative pathologies.
style
left-column

Specifications

Form

Liquid

Additional notes

ab99297 is purified using conventional chromatography techniques.

style
left-column

General info

Function

Involved in nuclear export of spliced and unspliced mRNA (PubMed : 15833825, PubMed : 15998806, PubMed : 17190602). Component of the TREX complex which is thought to couple mRNA transcription, processing and nuclear export, and specifically associates with spliced mRNA and not with unspliced pre-mRNA (PubMed : 15833825, PubMed : 15998806, PubMed : 17190602). The TREX complex is recruited to spliced mRNAs by a transcription-independent mechanism, binds to mRNA upstream of the exon-junction complex (EJC) and is recruited in a splicing- and cap-dependent manner to a region near the 5' end of the mRNA where it functions in mRNA export to the cytoplasm via the TAP/NXF1 pathway (PubMed : 15833825, PubMed : 15998806, PubMed : 17190602). The THOC1-THOC2-THOC3 core complex alone is sufficient to promote ATPase activity of DDX39B; in the complex THOC2 is the only component that directly interacts with DDX39B (PubMed : 33191911). Associates with SARNP/CIP29, which facilitates RNA binding of DDX39B and likely plays a role in mRNA export (PubMed : 37578863). May undergo several rounds of ATP hydrolysis during assembly of TREX to drive subsequent loading of components such as ALYREF/THOC4 and CHTOP onto mRNA. Also associates with pre-mRNA independent of ALYREF/THOC4. Involved in the nuclear export of intronless mRNA; the ATP-bound form is proposed to recruit export adapter ALYREF/THOC4 to intronless mRNA; its ATPase activity is cooperatively stimulated by RNA and ALYREF/THOC4 and ATP hydrolysis is thought to trigger the dissociation from RNA to allow the association of ALYREF/THOC4 and the NXF1-NXT1 heterodimer. Involved in transcription elongation and genome stability.. Splice factor that is required for the first ATP-dependent step in spliceosome assembly and for the interaction of U2 snRNP with the branchpoint. Has both RNA-stimulated ATP binding/hydrolysis activity and ATP-dependent RNA unwinding activity. Even with the stimulation of RNA, the ATPase activity is weak. Can only hydrolyze ATP but not other NTPs. The RNA stimulation of ATPase activity does not have a strong preference for the sequence and length of the RNA. However, ssRNA stimulates the ATPase activity much more strongly than dsRNA. Can unwind 5' or 3' overhangs or blunt end RNA duplexes in vitro. The ATPase and helicase activities are not influenced by U2AF2; the effect of ALYREF/THOC4 is reported conflictingly with [PubMed : 23299939] reporting a stimulatory effect.. (Microbial infection) The TREX complex is essential for the export of Kaposi's sarcoma-associated herpesvirus (KSHV) intronless mRNAs and infectious virus production.

Sequence similarities

Belongs to the DEAD box helicase family. DECD subfamily.

Subcellular localisation

Nucleus

style
left-column

Product protocols

style
left-column

Target data

Involved in nuclear export of spliced and unspliced mRNA (PubMed : 15833825, PubMed : 15998806, PubMed : 17190602). Component of the TREX complex which is thought to couple mRNA transcription, processing and nuclear export, and specifically associates with spliced mRNA and not with unspliced pre-mRNA (PubMed : 15833825, PubMed : 15998806, PubMed : 17190602). The TREX complex is recruited to spliced mRNAs by a transcription-independent mechanism, binds to mRNA upstream of the exon-junction complex (EJC) and is recruited in a splicing- and cap-dependent manner to a region near the 5' end of the mRNA where it functions in mRNA export to the cytoplasm via the TAP/NXF1 pathway (PubMed : 15833825, PubMed : 15998806, PubMed : 17190602). The THOC1-THOC2-THOC3 core complex alone is sufficient to promote ATPase activity of DDX39B; in the complex THOC2 is the only component that directly interacts with DDX39B (PubMed : 33191911). Associates with SARNP/CIP29, which facilitates RNA binding of DDX39B and likely plays a role in mRNA export (PubMed : 37578863). May undergo several rounds of ATP hydrolysis during assembly of TREX to drive subsequent loading of components such as ALYREF/THOC4 and CHTOP onto mRNA. Also associates with pre-mRNA independent of ALYREF/THOC4. Involved in the nuclear export of intronless mRNA; the ATP-bound form is proposed to recruit export adapter ALYREF/THOC4 to intronless mRNA; its ATPase activity is cooperatively stimulated by RNA and ALYREF/THOC4 and ATP hydrolysis is thought to trigger the dissociation from RNA to allow the association of ALYREF/THOC4 and the NXF1-NXT1 heterodimer. Involved in transcription elongation and genome stability.. Splice factor that is required for the first ATP-dependent step in spliceosome assembly and for the interaction of U2 snRNP with the branchpoint. Has both RNA-stimulated ATP binding/hydrolysis activity and ATP-dependent RNA unwinding activity. Even with the stimulation of RNA, the ATPase activity is weak. Can only hydrolyze ATP but not other NTPs. The RNA stimulation of ATPase activity does not have a strong preference for the sequence and length of the RNA. However, ssRNA stimulates the ATPase activity much more strongly than dsRNA. Can unwind 5' or 3' overhangs or blunt end RNA duplexes in vitro. The ATPase and helicase activities are not influenced by U2AF2; the effect of ALYREF/THOC4 is reported conflictingly with [PubMed : 23299939] reporting a stimulatory effect.. (Microbial infection) The TREX complex is essential for the export of Kaposi's sarcoma-associated herpesvirus (KSHV) intronless mRNAs and infectious virus production.
See full target information DDX39B
style
left-column
style
left-column
style
right-column

Complementary Products

Proteins & Peptides

AB98233

Recombinant Human THTPA protein

SDS-PAGE - Recombinant Human THTPA protein (AB98233)

  • 0
  • 0
Proteins & Peptides

AB101108

Recombinant Human TNIP1 protein

SDS-PAGE - Recombinant Human TNIP1 protein (AB101108)

  • 0
  • 0
Proteins & Peptides

AB97900

Recombinant Human STMN3 protein

SDS-PAGE - Recombinant Human STMN3 protein (AB97900)

  • 0
  • 0
Proteins & Peptides

AB99263

Recombinant Human Tryptophanyl tRNA synthetase/WRS protein

SDS-PAGE - Recombinant Human Tryptophanyl tRNA synthetase/WRS protein (AB99263)

  • 0
  • 0

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com