JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB269099

Recombinant human UBCH6/UBE2E1 protein (Active) (His tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant human UBCH6/UBE2E1 protein (Active) (His tag N-Terminus) is a Human Full Length protein, in the 2 to 193 aa range, expressed in Escherichia coli, with >95%, suitable for SDS-PAGE, FuncS.
2 Images
Functional Studies - Recombinant human UBCH6/UBE2E1 protein (Active) (His tag N-Terminus) (AB269099)
  • FuncS

Supplier Data

Functional Studies - Recombinant human UBCH6/UBE2E1 protein (Active) (His tag N-Terminus) (AB269099)

The specific activity of ab269099 was 3 nmol/min/mg in a ubiquinating assay using wild-type ubiquitin as substrate.

SDS-PAGE - Recombinant human UBCH6/UBE2E1 protein (Active) (His tag N-Terminus) (AB269099)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant human UBCH6/UBE2E1 protein (Active) (His tag N-Terminus) (AB269099)

SDS-PAGE analysis of ab269099.

Key facts

Purity

>95% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

FuncS, SDS-PAGE

applications

Biologically active

Yes

Biological activity

The specific activity of ab269099 was 3 nmol/min/mg in a ubiquinating assay using wild-type ubiquitin as substrate.

Accession

P51965-1

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7 Preservative: 1.02% Imidazole Constituents: 25% Glycerol (glycerin, glycerine), 1.74% Sodium chloride, 0.82% Sodium phosphate, 0.004% (R*,R*)-1,4-Dimercaptobutan-2,3-diol, 0.002% PMSF

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"linker":null,"sequence":"SDDDSRASTSSSSSSSSNQQTEKETNTPKKKESKVSMSKNSKLLSTSAKRIQKELADITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFTPEYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYMTNRAEHDRMARQWTKRYAT","proteinLength":"Full Length","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":193,"aminoAcidStart":2,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P51965","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Form
Liquid
Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

UBCH6 also known as UBE2E1 is a ubiquitin-conjugating enzyme with approximately 23 kDa molecular weight. It functions mechanically by transferring ubiquitin from an E1 enzyme to a substrate protein often requiring an E3 ligase to provide specificity. This action is an important step in the ubiquitination process which tags proteins for various fates such as degradation localization or activity modulation. UBCH6 expresses ubiquitously across many tissues with noticeable levels in the liver heart and kidney indicating its broad functional role in the human body.
Biological function summary

UBCH6 participates in the regulatory control of protein homeostasis. It acts as part of the ubiquitination system which involves post-translational modifications critical for maintaining cellular functions. UBCH6 often partners with various E3 ligases to ensure proper protein turnover and response to cellular stress. It ensures the selective degradation of misfolded or damaged proteins which is essential for preventing toxic accumulation within the cell. Through these interactions UBCH6 maintains protein quality control ensuring cellular health and function.

Pathways

UBCH6 involves itself in the ubiquitin-proteasome pathway and influences the NF-kB signaling pathway. The ubiquitin-proteasome pathway regulates protein degradation impacting numerous cellular processes such as cell cycle DNA repair and apoptosis. In these pathways UBCH6 interacts with related proteins such as ubiquilin and various E3 components like the cullin-RING ligases which aid its role in cellular regulation. Specifically in NF-kB signaling UBCH6 assists in modulating inflammatory responses and innate immune responses linking cellular stress to transcriptional changes.

UBCH6's functions connect to cancer and neurodegenerative diseases. Dysregulation in its activity or expression can lead to aberrant protein degradation pathways contributing to oncogenic transformations or impaired cell cycle control as seen in specific cancers. The association extends to proteins like p53 or IκB which are important in these conditions. Additionally in neurodegenerative disorders like Parkinson's disease UBCH6's interaction with proteins involved in protein aggregation or clearance like Parkin demonstrates its role in disease pathology highlighting its importance in maintaining neuronal health and preventing disease-related protein accumulations.

General info

Function

Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. Catalyzes the covalent attachment of ISG15 to other proteins. Mediates the selective degradation of short-lived and abnormal proteins. In vitro also catalyzes 'Lys-48'-linked polyubiquitination. Catalyzes monoubiquitination of other proteins in both an E3-dependent and E3-independent manner (PubMed : 27237050).

Sequence similarities

Belongs to the ubiquitin-conjugating enzyme family.

Post-translational modifications

ISGylation suppresses ubiquitin E2 enzyme activity.. Autoubiquitinated in vitro.

Product protocols

Target data

Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. Catalyzes the covalent attachment of ISG15 to other proteins. Mediates the selective degradation of short-lived and abnormal proteins. In vitro also catalyzes 'Lys-48'-linked polyubiquitination. Catalyzes monoubiquitination of other proteins in both an E3-dependent and E3-independent manner (PubMed : 27237050).
See full target information UBE2E1

Alternative Names

UBCH6, UBE2E1, Ubiquitin-conjugating enzyme E2 E1, (E3-independent) E2 ubiquitin-conjugating enzyme E1, E2 ubiquitin-conjugating enzyme E1, UbcH6, Ubiquitin carrier protein E1, Ubiquitin-protein ligase E1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com