JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB198472

Recombinant human UBE2V1 protein (DDDDK tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant human UBE2V1 protein (DDDDK tag N-Terminus) is a Human Full Length protein, in the 2 to 170 aa range, expressed in Escherichia coli, with >80%, suitable for SDS-PAGE, FuncS.

View Alternative Names

CROC1, UBE2V, UEV1, P/OKcl.19, UBE2V1, Ubiquitin-conjugating enzyme E2 variant 1, UEV-1, CROC-1, TRAF6-regulated IKK activator 1 beta Uev1A

2 Images
Functional Studies - Recombinant human UBE2V1 protein (DDDDK tag N-Terminus) (AB198472)
  • FuncS

Supplier Data

Functional Studies - Recombinant human UBE2V1 protein (DDDDK tag N-Terminus) (AB198472)

Functional studies of ab198472

SDS-PAGE - Recombinant human UBE2V1 protein (DDDDK tag N-Terminus) (AB198472)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant human UBE2V1 protein (DDDDK tag N-Terminus) (AB198472)

4-20% SDS PAGE analysis of 1 μg ab198472 stained with Coomassie

Key facts

Purity

>80% SDS-PAGE

Expression system

Escherichia coli

Tags

DDDDK tag N-Terminus

Applications

SDS-PAGE, FuncS

applications

Biologically active

Yes

Biological activity

50 μl reaction mix (4 mM ATP, 5 mM MgCl2, 1 mM DTT, UBE1 (0.5 μg), UEV1A or other E2, Biotin-Ubiquitin (0.5 μg) and Smurf2 (2 μg) in 50 mM Tris, pH 7.4) for 30 minutes at 37°C. Add to Streptavidin-coated plates for 30 minutes at 37°C. Incubate with anti-Smurf2, then HRP-labeled secondary antibody and chemiluminescent detection

Accession

Q13404

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 10% Glycerol (glycerin, glycerine), 0.72% Sodium chloride, 0.71% Tris HCl, 0.05% (R*,R*)-1,4-Dimercaptobutan-2,3-diol, 0.02% Potassium chloride

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"PGEVQASYLKSQSKLSDEGRLEPRKFHCKGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTIYENRIYSLKIECGPKYPEAPPFVRFVTKINMNGVNSSNGVVDPRAISVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQCYSN","proteinLength":"Full Length","predictedMolecularWeight":"20 kDa","actualMolecularWeight":null,"aminoAcidEnd":170,"aminoAcidStart":2,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q13404","tags":[{"tag":"DDDDK","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Storage information
Avoid freeze / thaw cycle
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

UBE2V1 also known as ubiquitin-conjugating enzyme E2 variant 1 acts as an E2-like enzyme facilitating the transfer of ubiquitin molecules to substrate proteins. It is a non-canonical ubiquitin-conjugating enzyme because it lacks the active cysteine residue needed to conjugate ubiquitin directly. The molecular mass of UBE2V1 is approximately 20 kDa. UBE2V1 is highly expressed in various human tissues including the spleen liver and placenta suggesting its broad role in cellular functions.
Biological function summary

UBE2V1 collaborates with UBE2N (also known as Ubc13) to form a heterodimer c. This dimer is involved in the process of K63-linked polyubiquitination which does not target proteins for proteasomal degradation but rather plays an important role in DNA damage tolerance and immune response regulation. UBE2V1 when associated with UBE2N aids in the polyubiquitination of protein substrates allowing for their involvement in regulatory mechanisms that are essential for cellular homeostasis.

Pathways

UBE2V1 serves an important function in the NF-κB signaling pathway and DNA repair processes. In the NF-κB pathway UBE2V1 through its interaction with UBE2N contributes to the activation of TAK1 kinase which ultimately activates the transcription factor NF-κB leading to inflammatory and immune responses. In DNA repair it participates in error-free damage bypass mechanism alongside UBE2N. These pathways highlight the integration of UBE2V1 in cellular processes that manage stress and damage responses.

UBE2V1 associates with cancer and immune disorders. Its role in the NF-κB pathway links it to oncogenic processes as deregulated NF-κB signaling often corresponds with tumorigenesis. In addition abnormalities in UBE2V1’s function may lead to aberrant immune responses as its partnership with UBE2N influences inflammatory reactions. Such dysregulation can contribute to both the initiation and progression of diseases like rheumatoid arthritis and various cancers marking UBE2V1 as a potential target for therapeutic intervention.

Specifications

Form

Liquid

Additional notes

Lot specific.

General info

Function

Has no ubiquitin ligase activity on its own. The UBE2V1-UBE2N heterodimer catalyzes the synthesis of non-canonical poly-ubiquitin chains that are linked through Lys-63. This type of poly-ubiquitination activates IKK and does not seem to involve protein degradation by the proteasome. Plays a role in the activation of NF-kappa-B mediated by IL1B, TNF, TRAF6 and TRAF2. Mediates transcriptional activation of target genes. Plays a role in the control of progress through the cell cycle and differentiation. Plays a role in the error-free DNA repair pathway and contributes to the survival of cells after DNA damage. Promotes TRIM5 capsid-specific restriction activity and the UBE2V1-UBE2N heterodimer acts in concert with TRIM5 to generate 'Lys-63'-linked polyubiquitin chains which activate the MAP3K7/TAK1 complex which in turn results in the induction and expression of NF-kappa-B and MAPK-responsive inflammatory genes. Together with RNF135 and UBE2N, catalyzes the viral RNA-dependent 'Lys-63'-linked polyubiquitination of RIGI to activate the downstream signaling pathway that leads to interferon beta production (PubMed : 31006531). UBE2V1-UBE2N together with TRAF3IP2 E3 ubiquitin ligase mediate 'Lys-63'-linked polyubiquitination of TRAF6, a component of IL17A-mediated signaling pathway.

Sequence similarities

Belongs to the ubiquitin-conjugating enzyme family.

Subcellular localisation

Nucleus

Product protocols

Target data

Has no ubiquitin ligase activity on its own. The UBE2V1-UBE2N heterodimer catalyzes the synthesis of non-canonical poly-ubiquitin chains that are linked through Lys-63. This type of poly-ubiquitination activates IKK and does not seem to involve protein degradation by the proteasome. Plays a role in the activation of NF-kappa-B mediated by IL1B, TNF, TRAF6 and TRAF2. Mediates transcriptional activation of target genes. Plays a role in the control of progress through the cell cycle and differentiation. Plays a role in the error-free DNA repair pathway and contributes to the survival of cells after DNA damage. Promotes TRIM5 capsid-specific restriction activity and the UBE2V1-UBE2N heterodimer acts in concert with TRIM5 to generate 'Lys-63'-linked polyubiquitin chains which activate the MAP3K7/TAK1 complex which in turn results in the induction and expression of NF-kappa-B and MAPK-responsive inflammatory genes. Together with RNF135 and UBE2N, catalyzes the viral RNA-dependent 'Lys-63'-linked polyubiquitination of RIGI to activate the downstream signaling pathway that leads to interferon beta production (PubMed : 31006531). UBE2V1-UBE2N together with TRAF3IP2 E3 ubiquitin ligase mediate 'Lys-63'-linked polyubiquitination of TRAF6, a component of IL17A-mediated signaling pathway.
See full target information UBE2V1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com