JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB161390

Recombinant Human UBP43/USP18 protein

Be the first to review this product! Submit a review

|

(1 Publication)

Recombinant Human UBP43/USP18 protein is a Human Fragment protein, in the 273 to 372 aa range, expressed in Wheat germ, suitable for ELISA, WB.

View Alternative Names

ISG43, USP18, Ubl carboxyl-terminal hydrolase 18, 43 kDa ISG15-specific protease, ISG15-specific-processing protease, Ubl thioesterase 18, hUBP43

1 Images
SDS-PAGE - Recombinant Human UBP43/USP18 protein (AB161390)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human UBP43/USP18 protein (AB161390)

ab161390 on a 12.5% SDS-PAGE stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

ELISA, WB

applications

Biologically active

No

Accession

Q9UMW8

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

This product was previously labelled as UBP43.

Sequence info

[{"sequence":"LYFPQSLDFSQILPMKRESCDAEEQSGGQYELFAVIAHVGMADSGHYCVYIRNAVDGKWFCFNDSNICLVSWEDIQCTYGNPNYHWQETAYLLVYMKMEC","proteinLength":"Fragment","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":372,"aminoAcidStart":273,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"Q9UMW8","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

UBP43 also known as USP18 is a deubiquitinating enzyme that is 43 kilodaltons in mass. This protein removes ubiquitin from ubiquitinated proteins which regulates their degradation and stability. UBP43 is expressed widely in the body with significant levels in the immune and nervous systems. Its alternate name USP18 reflects its inclusion in the ubiquitin-specific protease family highlighting its specific function in modulating protein ubiquitination.
Biological function summary

UBP43 regulates type I interferon signaling and affects immune response. As a negative feedback regulator it inhibits the interferon signaling pathway preventing unnecessary immune reactions. UBP43 does not form a part of a larger protein complex but acts independently to maintain cellular homeostasis. Its activity impacts the function of other proteins involved in response to viral infections.

Pathways

UBP43 plays an important role in the JAK-STAT signaling pathway interacting with proteins involved in cytokine signaling. It influences the pathway by inhibiting the action of interferon-stimulated genes therefore modulating the immune response. UBP43's interaction with ISG15 a ubiquitin-like modifier is also a critical aspect that affects other cellular processes like protein modification and response to inflammatory stimuli.

UBP43 is closely linked to autoimmune diseases and viral infections. Altered UBP43 activity can lead to improper immune responses contributing to conditions such as systemic lupus erythematosus. It also plays a role in the body's defense against viral infections where its dysregulation may affect the efficiency of antiviral responses. The interplay between UBP43 and ISG15 is of particular interest as changes in their interaction could provide insights into the development or progression of these disorders.

Specifications

Form

Liquid

General info

Function

Interferon-induced ISG15-specific protease that plays a crucial role for maintaining a proper balance of ISG15-conjugated proteins in cells (PubMed : 11788588). Regulates protein ISGylation by efficiently cleaving ISG15 conjugates linked via isopeptide bonds. Regulates T-cell activation and T-helper 17 (Th17) cell differentiation by deubiquitinating TAK1, likely to keep TAK1-TAB complexes in steady conditions (PubMed : 23825189). In turn, restricts activation of NF-kappa-B, NFAT, and JNK as well as expression of IL2 in T-cells after TCR activation (PubMed : 23825189). Acts as a molecular adapter with USP20 to promote innate antiviral response through deubiquitinating STING1 (PubMed : 27801882). Involved also in the negative regulation of the inflammatory response triggered by type I interferon (PubMed : 27325888, PubMed : 28165510). Upon recruitment by STAT2 to the type I interferon receptor subunit IFNAR2 interferes with the assembly of the ternary interferon-IFNAR1-IFNAR2 complex and acts as a negative regulator of the type I interferon signaling pathway (PubMed : 28165510).. Isoform 2. Has enzymatic activity similar to isoform 1 and interferes with type I interferon signaling. Major deISGylation enzyme for nuclear proteins (PubMed : 22170061).

Sequence similarities

Belongs to the peptidase C19 family.

Subcellular localisation

Nucleus

Product protocols

Target data

Interferon-induced ISG15-specific protease that plays a crucial role for maintaining a proper balance of ISG15-conjugated proteins in cells (PubMed : 11788588). Regulates protein ISGylation by efficiently cleaving ISG15 conjugates linked via isopeptide bonds. Regulates T-cell activation and T-helper 17 (Th17) cell differentiation by deubiquitinating TAK1, likely to keep TAK1-TAB complexes in steady conditions (PubMed : 23825189). In turn, restricts activation of NF-kappa-B, NFAT, and JNK as well as expression of IL2 in T-cells after TCR activation (PubMed : 23825189). Acts as a molecular adapter with USP20 to promote innate antiviral response through deubiquitinating STING1 (PubMed : 27801882). Involved also in the negative regulation of the inflammatory response triggered by type I interferon (PubMed : 27325888, PubMed : 28165510). Upon recruitment by STAT2 to the type I interferon receptor subunit IFNAR2 interferes with the assembly of the ternary interferon-IFNAR1-IFNAR2 complex and acts as a negative regulator of the type I interferon signaling pathway (PubMed : 28165510).. Isoform 2. Has enzymatic activity similar to isoform 1 and interferes with type I interferon signaling. Major deISGylation enzyme for nuclear proteins (PubMed : 22170061).
See full target information USP18

Publications (1)

Recent publications for all applications. Explore the full list and refine your search

BMC cancer 25:528 PubMed40122823

2025

Deubiquitinase USP18 mediates cell migration, apoptosis and ferroptosis in lung adenocarcinoma by depending on POU4F1/PRKAA2 axis.

Applications

Unspecified application

Species

Unspecified reactive species

Xinping Pan,Hui Deng
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com